Polypeptide MELO3C005214P1
Accession: MELO3C005214P1
Name: MELO3C005214P1
Description: Similar to Defensin-like protein 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39182|DEF02_ARATH)
Sequence:
>MELO3C005214P1 Similar to Defensin-like protein 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39182|DEF02_ARATH) MKFLSAAIFLLLLLLGTGMGPMVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHCV*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: extracellular region.
biological_process: defense response to fungus, killing of cells of other organism.
This polypeptide in other databases
In PhylomeDB is Phy003LKPB_CUCME .
