Polypeptide MELO3C005422P1
Accession: MELO3C005422P1
Name: MELO3C005422P1
Description: Similar to ADP-ribosylation factor (Ajellomyces capsulata) (uniprot_sprot:sp|P34727|ARF_AJECA)
Sequence:
>MELO3C005422P1 Similar to ADP-ribosylation factor (Ajellomyces capsulata) (uniprot_sprot:sp|P34727|ARF_AJECA) MGQAFRKLFDSFFGNSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKNVVFTVWDVGGQEKLRPLWRH YFNNTDGLIYVVDSLDRERIGKAKTEFQAIINDPFMLNSVILVFANKQDMEDKRSNFHTLALKCKVIGAYAVKV*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: GTP binding, transporter activity.
cellular_component: intracellular.
biological_process: small GTPase mediated signal transduction, ER to Golgi vesicle-mediated transport, intracellular protein transport.
These properties come from reactome analysis
REACTOME_REACTION: trans-Golgi Network Coat Activation (REACT_64759), Arf1 Activation by GBF1 (REACT_83517), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_85129), Coat Complex Formation (REACT_110599), Coat Complex Formation (REACT_107743).
biological_process: COPI coating of Golgi vesicle, cellular membrane organization, retrograde vesicle-mediated transport, Golgi to ER, post-Golgi vesicle-mediated transport.
REACTOME_PATHWAY: Clathrin derived vesicle budding (REACT_94264), Golgi to ER Retrograde Transport (REACT_88478), trans-Golgi Network Vesicle Budding (REACT_34456), COPI Mediated Transport (REACT_76996), Membrane Trafficking (REACT_78213), COPI Mediated Transport (REACT_33101), Golgi to ER Retrograde Transport (REACT_101581), Membrane Trafficking (REACT_91154).
These properties come from phylome analysis
molecular_function: thioesterase binding, NAD(P)+-protein-arginine ADP-ribosyltransferase activity, GTPase activity, GTP binding.
cellular_component: recycling endosome, endosome membrane, cell cortex, plasma membrane, cytosol, Golgi apparatus, early endosome, membrane fraction, ruffle.
biological_process: positive regulation of establishment of protein localization in plasma membrane, regulation of dendritic spine development, synaptic vesicle endocytosis, negative regulation of receptor-mediated endocytosis, regulation of Rac protein signal transduction, protein localization at cell surface, ruffle organization, cortical actin cytoskeleton organization, positive regulation of actin filament polymerization, endosome transport, vesicle-mediated transport, protein transport, myoblast fusion, spermatogenesis, neurotransmitter secretion, cell adhesion, male meiosis cytokinesis, cellular component movement, protein ADP-ribosylation, small GTPase mediated signal transduction.
These properties come from kegg analysis
KEGG_ORTHOLOGS: Arf/Sar family, other (K07977).
This polypeptide in other databases
In PhylomeDB is Phy003MER3_CUCME .