Polypeptide MELO3C005515P2

Accession: MELO3C005515P2

Name: MELO3C005515P2

Description: Similar to Peroxisomal acyl-coenzyme A oxidase 1 (Arabidopsis thaliana) (uniprot_sprot:sp|O65202|ACOX1_ARATH)

Sequence:

>MELO3C005515P2 Similar to Peroxisomal acyl-coenzyme A oxidase 1 (Arabidopsis thaliana) (uniprot_sprot:sp|O65202|ACOX1_ARATH)
MEGVDHLAHERNKAQFDVNDMKIVWAGSREAFEVSDRMSRLVANDPAFRKDNRVHLTRKELFKNTLRKAAYAWKKIIELK
LSEEEAGRLRFFVDEPAYTDLHWGMFVPFLKGQGTEEQLKKWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPKTD
EFVIHSPTLTSSKWWPGGLGKVSTHAVVFARLITNGQDYGVHGFIVQIRSLDDHSVLPGITIGDIGVKFGNGAYNTMDNG
VMHFDHIRIPRNQLLMRFSQVTREGKYVQSDVPRQLVYGTMVYVRKTIVIDASNALSRAVCIATRYSAVRRQFGSQDGAE
NQVINYKTQQSRLFPLLASAYAFRFVGEWLQWLYTDVTQRLAANDFSTLPEAHACTAGLKSITTAATADGIEECRKLCGG
HGYLCSSGLPELFAVYVPACTYEGDNVVLLLQVARFLVKTVSQLVSGKKPVGTTAYMGRLQRLMESTCKVQKAEDWLNPS
IVLEAFEVRSARMSVECAKRLSQFTNQEEGFHELSPSLVEAAVAHCQLIIVSKFIEKLQGDIPGNGVKEQLQKLCSIYAL
YTLHKHLGDFLSTSTITPKQASLADDQLRSLYAQVRPNAVALVDAFNYTDHYLGSILGRYDGNVYPKLYDEAWKDPMNDT
AVPDGYHEYIRPLLKQQLRNSRL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: flavin adenine dinucleotide binding, electron carrier activity, cytochrome-c oxidase activity, acyl-CoA oxidase activity, acyl-CoA dehydrogenase activity.

cellular_component: peroxisome.

biological_process: oxidation-reduction process, fatty acid beta-oxidation.

These properties come from reactome analysis


REACTOME_REACTION: (2S)-pristanoyl-CoA + O2 => trans-2,3-dehydropristanoyl-CoA + H2O2 (ACOX2) (REACT_99773), hexacosanoyl-CoA + O2 => trans-2,3-dehydrohexacosanoyl-CoA + H2O2 (REACT_97066), hexacosanoyl-CoA + O2 => trans-2,3-dehydrohexacosanoyl-CoA + H2O2 (REACT_81057), (2S)-pristanoyl-CoA + O2 => trans-2,3-dehydropristanoyl-CoA + H2O2 (ACOX2) (REACT_109682), 25(S) THCA-CoA is dehydrogenated to 25(S) 3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA (REACT_105955), 25(S) THCA-CoA is dehydrogenated to 25(S) 3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA (REACT_78214), 25(S) DHCA-CoA is dehydrogenated to 25(S) 3alpha,7alpha-dihydroxy-5beta-cholest-24-enoyl-CoA (REACT_95380), 25(S) DHCA-CoA is dehydrogenated to 25(S) 3alpha,7alpha-dihydroxy-5beta-cholest-24-enoyl-CoA (REACT_97865).

biological_process: cellular lipid metabolic process, bile acid metabolic process, bile acid biosynthetic process, fatty acid beta-oxidation using acyl-CoA oxidase.

REACTOME_PATHWAY: Synthesis of bile acids and bile salts (REACT_82865), Synthesis of bile acids and bile salts (REACT_99724), Peroxisomal lipid metabolism (REACT_81319), Beta-oxidation of pristanoyl-CoA (REACT_31512), Metabolism of lipids and lipoproteins (REACT_79403), Beta-oxidation of pristanoyl-CoA (REACT_81180), Beta-oxidation of very long chain fatty acids (REACT_101952), Bile acid and bile salt metabolism (REACT_81692), Beta-oxidation of very long chain fatty acids (REACT_102511), Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (REACT_96571), Bile acid and bile salt metabolism (REACT_96936), Metabolism of lipids and lipoproteins (REACT_81798), Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (REACT_28083), Peroxisomal lipid metabolism (REACT_98520).

These properties come from phylome analysis


molecular_function: flavin adenine dinucleotide binding, cytochrome-c oxidase activity, acyl-CoA oxidase activity, acyl-CoA dehydrogenase activity.

cellular_component: peroxisome.

biological_process: oxidation-reduction process, fatty acid beta-oxidation.

These properties come from kegg analysis


KEGG_REACTION: hydroxycinnamoyl-CoA:anthocyanidin (R07950), hydroxycinnamoyl-CoA:anthocyanidin (R07934), hydroxycinnamoyl-CoA:anthocyanidin (R07896), hydroxycinnamoyl-CoA:anthocyanidin (R07892), hydroxycinnamoyl-CoA:anthocyanidin (R07888), Decanoyl-CoA:(acceptor) (R04754), Hexanoyl-CoA:(acceptor) (R04751), Tetradecanoyl-CoA:(acceptor) (R03990), Lauroyl-CoA:(acceptor) (R03857), Octanoyl-CoA:oxygen (R03777), Palmitoyl-CoA:oxygen (R01279), Butanoyl-CoA:oxygen (R01175).

molecular_function: acyl-CoA oxidase activity.

Locations

Located in CM3.5_scaffold00005 from 5623223 to 5627835.

This polypeptide in other databases

In PhylomeDB is Phy003A44P_CUCME .

Related features