Polypeptide MELO3C005662P3

Accession: MELO3C005662P3

Name: MELO3C005662P3

Description: Similar to Probable serine racemase (Dictyostelium discoideum) (uniprot_sprot:sp|Q54HH2|SRR_DICDI)

Sequence:

>MELO3C005662P3 Similar to Probable serine racemase (Dictyostelium discoideum) (uniprot_sprot:sp|Q54HH2|SRR_DICDI)
MNAESQNKKKEYAADISSIKEARIRIRPFIHETPVFSSETINAASGKRLFFKCECFQKGGAFKIRGACNAIYSLDEGEAA
KGVVTHSSGNHAAALSLAAKLRGIPAYIVIPENAPKCKVENVIRYGGQIIWSKATIQSRESVAARVMQETGALLIHPYND
GRIISGQGTISLELLEQVPQLDTLIVPISGGGLISGISVAAKAINPAIRIFAAEPKGANDVAMSKAAGKIVTLPETTTIA
DGLRAFLGDLTWPIVRDLVDDVITVEDTEIIEAMRLCLEILKVVVEPSGAIGLAAVLSDSFKQNPSWKDCNSIGIILSGG
NVDLGMLWNSYKK*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_REACTION: serine (R00589).

KEGG_ORTHOLOGS: serine racemase [EC:5.1.1.18] (K12235).

molecular_function: serine racemase activity.

These properties come from phylome analysis


molecular_function: protein homodimerization activity, serine racemase activity, PDZ domain binding, threonine racemase activity, glycine binding, D-serine ammonia-lyase activity, ATP binding, calcium ion binding, L-serine ammonia-lyase activity, catalytic activity, magnesium ion binding, pyridoxal phosphate binding, L-threonine ammonia-lyase activity.

cellular_component: neuronal cell body, cytoplasm, soluble fraction.

biological_process: D-serine biosynthetic process, protein homotetramerization, pyruvate biosynthetic process, response to lipopolysaccharide, serine family amino acid metabolic process, L-serine metabolic process, cellular amino acid metabolic process.

These properties come from blast2go analysis


molecular_function: pyridoxal phosphate binding, isomerase activity, L-threonine ammonia-lyase activity.

biological_process: cellular amino acid metabolic process.

Locations

Located in CM3.5_scaffold00005 from 6810514 to 6814233.

This polypeptide in other databases

In PhylomeDB is Phy003LK3X_CUCME .

Related features