Polypeptide MELO3C005802P1
Accession: MELO3C005802P1
Name: MELO3C005802P1
Description: Similar to Mitochondrial import inner membrane translocase subunit Tim13 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9XH48|TIM13_ARATH)
Sequence:
>MELO3C005802P1 Similar to Mitochondrial import inner membrane translocase subunit Tim13 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9XH48|TIM13_ARATH) MDSFSSPSSGSSPQFSANEFRDQLKTQLAQAYAEEFLETLRVKCFDKCITKPGSSLSGSESSCISRCMERYIEATSIVSR ALFKTPH*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity, zinc ion binding.
cellular_component: mitochondrial intermembrane space protein transporter complex, mitochondrial inner membrane.
biological_process: transmembrane transport, protein import into mitochondrial inner membrane.
These properties come from phylome analysis
molecular_function: metal ion binding, protein binding, copper ion binding, zinc ion binding.
cellular_component: mitochondrial inner membrane presequence translocase complex, mitochondrial intermembrane space protein transporter complex, mitochondrial inner membrane.
biological_process: sensory perception of sound, transmembrane transport, protein import into mitochondrial inner membrane.
This polypeptide in other databases
In PhylomeDB is Phy003A3SY_CUCME .
