Polypeptide MELO3C005895P1

Accession: MELO3C005895P1

Name: MELO3C005895P1

Description: Similar to Importin subunit beta-1 (Mus musculus) (uniprot_sprot:sp|P70168|IMB1_MOUSE)

Sequence:

>MELO3C005895P1 Similar to Importin subunit beta-1 (Mus musculus) (uniprot_sprot:sp|P70168|IMB1_MOUSE)
MVLQLVPVIMMELHNTLEGQKLSSDERERQGELQGLLCGCLQVLIQRLGSSEATKYMFMQYADNMMGLFLRVFACRNATV
HEEAMLAIGALAYATGPEFAKYMSEFYKYIEMGLQNFEEYQVCAVTVGVVGDVCRALEDKILPYCDGIMTQLLKNLSSDQ
LHRSVKPPIFSCFGDIALAIGENFEKYLMYGMPMLQRAAELSAHTAGADDEMTEYTNSLRNGILEAYSGIFQGFKSSPKT
QLLIPYAPHILQFLDSIYMGKDMDEVVMKTAIGVLGDLADTLGSNAGSLIQQSVSSKDFLSECLSSDDHLIKESAEWAKL
AISRAISI*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Translocation of DFF to the nucleus (REACT_80280), Translocation of Rev:importin-beta:B23 to the nucleus (REACT_9521), Disassembly of the Rev-importin beta-B23:Ran-GTP complex (REACT_9456), Release of the RNP into the host cell nucleus (REACT_6164), Docking and transport of the RNP:Karyopherin complex through the nuclear pore (REACT_6289), Translocation of DFF to the nucleus (REACT_13544), Rev associates with B23 (REACT_9511), Recruitment of Karyopherin Beta to form a Trimeric Complex (REACT_6322), Rev:importin beta:B23 recruited to the nuclear pore (REACT_9516), Association of Ran-GTP with importin-beta (REACT_9399), Association of DFF with alpha:beta importin (REACT_13756), Association of multimerized Rev with beta-importin (REACT_9394).

biological_process: apoptosis, viral reproduction, DNA fragmentation involved in apoptotic nuclear change, cellular component disassembly involved in apoptosis, viral genome transport in host cell, viral infectious cycle.

REACTOME_COMPLEX: Importin beta-1:Rev multimer complex [nucleoplasm] (REACT_9823), Rev:Importin-beta:B23 [nucleoplasm] (REACT_9742), Importin-beta:Ran GTP complex [nucleoplasm] (REACT_9883), Rev:Importin-beta:B23 [cytosol] (REACT_9868), nucleoporin-associated Rev:Importin-beta:B23 complex [nuclear envelope] (REACT_9793), importin-alpha:importin-beta [cytosol] (REACT_13986), Rev:importin-beta:B23:Ran-GTP complex [nucleoplasm] (REACT_9842), RNP:Karyopherin alpha:Karyopherin beta complex [cytosol] (REACT_9158), DFF:associated with the importin-alpha:importin-beta complex [nucleoplasm] (REACT_14003), DFF:associated with the importin-alpha:importin-beta complex [cytosol] (REACT_14680), RNP:Karyopherin alpha:Karyopherin beta complex [nucleoplasm] (REACT_9341), Importin beta-1:Rev multimer complex [cytosol] (REACT_9841), importin-alpha:importin-beta complex [nucleoplasm] (REACT_13922).

REACTOME_PATHWAY: HIV Infection (REACT_6185), Apoptotic execution phase (REACT_81021), Host Interactions of HIV factors (REACT_6288), Influenza Infection (REACT_6167), Apoptosis (REACT_578), Apoptotic execution phase (REACT_995), Influenza Life Cycle (REACT_6145), Transport of Ribonucleoproteins into the Host Nucleus (REACT_6248), Interactions of Rev with host cellular proteins (REACT_6916), Activation of DNA fragmentation factor (REACT_13462), Activation of DNA fragmentation factor (REACT_93343), Apoptosis (REACT_100045), Apoptosis induced DNA fragmentation (REACT_92967), Nuclear import of Rev protein (REACT_9395), Apoptosis induced DNA fragmentation (REACT_1213).

These properties come from blast2go analysis


molecular_function: protein transporter activity, binding.

cellular_component: nuclear pore.

biological_process: protein import into nucleus, docking.

Locations

Located in CM3.5_scaffold00005 from 8576978 to 8578050.

This polypeptide in other databases

In PhylomeDB is Phy003A9ZO_CUCME .

Related features