Polypeptide MELO3C005976P1

Accession: MELO3C005976P1

Name: MELO3C005976P1

Description: Similar to Protein AATF (Mus musculus) (uniprot_sprot:sp|Q9JKX4|AATF_MOUSE)

Sequence:

>MELO3C005976P1 Similar to Protein AATF (Mus musculus) (uniprot_sprot:sp|Q9JKX4|AATF_MOUSE)
MGSASKRERKLQAIGSGSEDFEDIDDFELPVEEEEYLSDEDDNSGNEEEEVEDDEDEDEDEEQLEEEDGGEEDRKDAEME
ELEKEYMDLRHQEQDILKNLRQHKDEDFLKGQAVKNQRALWDKSLELRFLLQKAFSNSNRLPKEPIKSSFCELDNGVEVA
FSDLITSSKNTLNSLLELQEALLENNKHIVQATDGTTKLLESSRISNTHNEDDEDWSRVAQMHQRIGAFRDKSIDKWHRK
TQVTTGAAAIKGKLQAFNQNISEQVAAYMRDPSRMLNQMQLGRSAVHVFGTVLDESKSKEQEAQVEGGDPELFDDSEFYQ
QLLKEFFETIDPNSSETAFYALKKLQTKKRKIVDRRASKSRKIRYTVHEKIVNFMTPMPVDLHQATPKLVNNIFGLKSHM
STTTTAV*

Download fasta sequence.

Properties

These properties come from blast2go analysis


cellular_component: cytoplasm, nucleus.

biological_process: regulation of cellular process.

These properties come from reactome analysis


biological_process: nerve growth factor receptor signaling pathway, induction of apoptosis by extracellular signals, apoptosis.

REACTOME_REACTION: NRAGE sequesters CHE1 in the cytoplasm (REACT_13683).

REACTOME_COMPLEX: NGF ligand:p75NTR:NRAGE:CHE1 [plasma membrane] (REACT_14340).

REACTOME_PATHWAY: NRAGE signals death through JNK (REACT_13638), Cell death signalling via NRAGE, NRIF and NADE (REACT_13720), p75 NTR receptor-mediated signalling (REACT_13776), Signalling by NGF (REACT_11061).

These properties come from phylome analysis


molecular_function: leucine zipper domain binding, protein binding, sequence-specific DNA binding transcription factor activity.

cellular_component: 90S preribosome, focal adhesion, centrosome, nucleolus, nucleus.

biological_process: nerve growth factor receptor signaling pathway, positive regulation of transcription from RNA polymerase II promoter, negative regulation of superoxide anion generation, vesicle-mediated transport, protein transport, induction of apoptosis by extracellular signals, response to DNA damage stimulus, anti-apoptosis, apoptosis, rRNA processing.

These properties come from kegg analysis


KEGG_ORTHOLOGS: protein AATF/BFR2 (K14782).

Locations

Located in CM3.5_scaffold00006 from 334338 to 338070.

This polypeptide in other databases

In PhylomeDB is Phy003A8HU_CUCME .

Related features