Polypeptide MELO3C006096P1
Accession: MELO3C006096P1
Name: MELO3C006096P1
Description: Similar to DNA replication complex GINS protein SLD5 (Mus musculus) (uniprot_sprot:sp|Q99LZ3|SLD5_MOUSE)
Sequence:
>MELO3C006096P1 Similar to DNA replication complex GINS protein SLD5 (Mus musculus) (uniprot_sprot:sp|Q99LZ3|SLD5_MOUSE) MASNLGGASISQTDDFETFTPTTDVEPLKRAWRNEKAAPEILPYEASLVGRIKEQIQAMEDSIEEYSRSGIDPLIVSLYQ MDLDRIQFLLRSYIRSRLQKIEKYMLYILKSDELFRRLSKEEITFTDRCRHDMKKHFDESVLSKLPNNYQDVLKQSITSE EDDMVPEPPLDTFVVCKSKEYLEHIQLEDEEERASSRIEEPFEMEANVLHIIRYRPIKSLVESGRIDLL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: plastid.
These properties come from reactome analysis
biological_process: DNA strand elongation involved in DNA replication, mitotic cell cycle, S phase of mitotic cell cycle.
REACTOME_REACTION: Multiple proteins are localized at replication fork (REACT_6963), Multiple proteins are localized at replication fork (REACT_83344), Multiple proteins are localized at replication fork (REACT_77137), Formation of GINS complex (REACT_6747), Multiple proteins are localized at replication fork (REACT_28298), Multiple proteins are localized at replication fork (REACT_93102), Multiple proteins are localized at replication fork (REACT_94448).
REACTOME_COMPLEX: Unwinding complex at replication fork [nucleoplasm] (REACT_7007), GINS complex [nucleoplasm] (REACT_7704).
REACTOME_PATHWAY: Synthesis of DNA (REACT_29939), Synthesis of DNA (REACT_31294), DNA strand elongation (REACT_85667), DNA Replication (REACT_383), Unwinding of DNA (REACT_93501), S Phase (REACT_82813), DNA strand elongation (REACT_107311), Unwinding of DNA (REACT_91767), Cell Cycle, Mitotic (REACT_152), Unwinding of DNA (REACT_6776), Cell Cycle, Mitotic (REACT_85950), Unwinding of DNA (REACT_100553), Unwinding of DNA (REACT_98532), S Phase (REACT_81914), Synthesis of DNA (REACT_2014), Synthesis of DNA (REACT_77553), Cell Cycle, Mitotic (REACT_84794), DNA strand elongation (REACT_84115), S Phase (REACT_105829), S Phase (REACT_34043), Synthesis of DNA (REACT_29575), Cell Cycle, Mitotic (REACT_108233), DNA strand elongation (REACT_84140), DNA Replication (REACT_101785), DNA Replication (REACT_85544), S Phase (REACT_899), DNA Replication (REACT_102375), Cell Cycle, Mitotic (REACT_90846), DNA Replication (REACT_96557), Unwinding of DNA (REACT_105674), S Phase (REACT_89318), DNA strand elongation (REACT_83094), Synthesis of DNA (REACT_98237), DNA Replication (REACT_106731), DNA strand elongation (REACT_932), Cell Cycle, Mitotic (REACT_96281).
These properties come from phylome analysis
molecular_function: protein binding.
cellular_component: replication fork protection complex, DNA replication preinitiation complex, cytoplasm, nucleoplasm, nucleus, GINS complex.
biological_process: positive regulation of S phase of mitotic cell cycle, embryo development ending in birth or egg hatching, DNA strand elongation involved in DNA replication, DNA-dependent DNA replication initiation, DNA-dependent DNA replication, DNA replication, double-strand break repair via break-induced replication, mitotic cell cycle, S phase of mitotic cell cycle.
These properties come from kegg analysis
KEGG_ORTHOLOGS: GINS complex subunit 4 (K10735).
KEGG_MODULE: GINS complex (M00286).
This polypeptide in other databases
In PhylomeDB is Phy003A987_CUCME .