Polypeptide MELO3C006105P1

Accession: MELO3C006105P1

Name: MELO3C006105P1

Description: Similar to Probable anion transporter 2, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q8GX78|ANTR2_ARATH)

Sequence:

>MELO3C006105P1 Similar to Probable anion transporter 2, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q8GX78|ANTR2_ARATH)
MAIGSLVSNRNFGSFVGSGKVCKTEKASSHHGVERSVIFAAQYGQPNLFFRKSLGLRLNSSSPKIACSTFLQSITRDGKL
FKPLGVCTDETAGPRLPFIKSTITWSRRKCRCYPQCTSACILSNGPSWLQCQKSRYVKVDRTSANYKSNDFDITKGDVDA
LALAEGSGDAFFMEENEQIVSPWWESFPKRWVIVLLCFFSFLLCNMDRVNMSIAILPMSKEFNWNSATVGLIQSSFFWGY
LLTQIVGGIWADKIGGKLVLGFGVVWWSIATILTPIAARIGLPFLLMMRAFMGIGEGVAMPAMNNIISKWIPVSERSRSL
ALVYSGMYLGSVTGLAFSPVLIHKFGWPSVFYSFGSLGSIWFALWLTKAYSSPKEDPGLSAKEKKIIFDGSISKEPVKVI
PWKLILSKAPVWALIISHFCHNWGTFILLTWMPTYYNQVLKFNLTESGLFCVLPWLTMAVFANIGGWIADTLVSRGFSIT
TVRKIMQSIGFLGPAFFLTQLSHVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLSNTAGVLAGVFGTA
ATGFILQRGSWDDVFKVSVALYIIGTLVWNIFATGEKILD*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: L-Glutamate loading of synaptic vesicle (REACT_12503), release of L-Glutamate at the synapse (REACT_12411), Proton-coupled sialic acid co-transport (REACT_19297), Glutamate synaptic vesicle docking and priming (REACT_12617), Vesicular glutamate transport (REACT_19233), Vesicular glutamate transport (REACT_83766), Vesicular glutamate transport (REACT_108641).

biological_process: synaptic transmission, neurotransmitter secretion, glutamate secretion, ion transport, transmembrane transport.

REACTOME_COMPLEX: Empty Glutamate Synaptic Vesicle [cytosol] (REACT_14482), Docked Glutamate Loaded Synaptic Vesicle [plasma membrane] (REACT_12825), Glutamate loaded synaptic vesicle [cytosol] (REACT_12769).

REACTOME_PATHWAY: Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_91958), Transmembrane transport of small molecules (REACT_102897), Neurotransmitter Release Cycle (REACT_13723), Amino acid and oligopeptide SLC transporters (REACT_30787), Glutamate Neurotransmitter Release Cycle (REACT_12591), Synaptic Transmission (REACT_13685), Transmission across Chemical Synapses (REACT_13477), Amino acid and oligopeptide SLC transporters (REACT_28556), Organic anion transporters (REACT_100100), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_79109), SLC-mediated transmembrane transport (REACT_101577), SLC-mediated transmembrane transport (REACT_19118), Organic anion transporters (REACT_19372), Transmembrane transport of small molecules (REACT_15518), Organic anion transporters (REACT_100816), Transmembrane transport of small molecules (REACT_86409), SLC-mediated transmembrane transport (REACT_98716), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_19397), Amino acid and oligopeptide SLC transporters (REACT_19419).

These properties come from phylome analysis


molecular_function: inorganic phosphate transmembrane transporter activity.

cellular_component: chloroplast membrane, integral to membrane, chloroplast inner membrane.

biological_process: ion transport, transmembrane transport.

These properties come from blast2go analysis


molecular_function: transporter activity.

cellular_component: chloroplast inner membrane, chloroplast thylakoid membrane.

biological_process: transmembrane transport.

Locations

Located in CM3.5_scaffold00006 from 1077257 to 1084000.

This polypeptide in other databases

In PhylomeDB is Phy003A8WG_CUCME .

Related features