Polypeptide MELO3C006150P1
Accession: MELO3C006150P1
Name: MELO3C006150P1
Description: Similar to Ribosomal RNA small subunit methyltransferase A (Protochlamydia amoebophila (strain UWE25)) (uniprot_sprot:sp|Q6ME80|RSMA_PARUW)
Sequence:
>MELO3C006150P1 Similar to Ribosomal RNA small subunit methyltransferase A (Protochlamydia amoebophila (strain UWE25)) (uniprot_sprot:sp|Q6ME80|RSMA_PARUW) MAAPPLPNPFLPPFSFTSYRQSPNLYFPASTAIAGSRWAIPFVSCSAATVRVGEGVNPDDYHSTLRALNSKGRVPRKSLG QHYMLNSSINEQLAAAANVKEGDVVLEIGPGTGSLTNVLINSGATVLAVEKDSYMAALVDERFANTNRLKVLNEDFVKCH VSSHMMSFLKSIELSEARSQPAKVVSNIPFNISTDIIKQLLPMGDIFSEVVLLLQEEAALRLVETSLRRSEYRPINVFVN FYSDPELKFKVPRTNFFPQPNVDAAVVSFKLKQAADCPAVSSTKSFFSMVNSAFNGKRKMLRKSLQHICTSSEIEKALED SSLPPTSRPEELSLDDFVRLHNLIVKQ*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: rRNA (adenine-N6-)-methyltransferase activity, rRNA (adenine-N6,N6-)-dimethyltransferase activity.
cellular_component: plastid.
biological_process: rRNA modification.
These properties come from phylome analysis
molecular_function: rRNA (adenine-N6-)-methyltransferase activity, rRNA (adenine-N6,N6-)-dimethyltransferase activity.
cellular_component: cytoplasm.
biological_process: response to cold.
This polypeptide in other databases
In PhylomeDB is Phy003A46T_CUCME .

