Polypeptide MELO3C006263P2

Accession: MELO3C006263P2

Name: MELO3C006263P2

Description: Similar to Acyl carrier protein, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|P53665|ACPM_ARATH)

Sequence:

>MELO3C006263P2 Similar to Acyl carrier protein, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|P53665|ACPM_ARATH)
MALRAAVLRHLRVPVQFSALARRECQPAPCSDGYLRLFSSHDDRSTKEEVTERVLSVIKRHTKVDPSKVSPNVHFQKDLG
LDSLDTVEIVMALEEEFKLEIPDNEADKIDSCDLAIDERIFISTLFF*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: cofactor binding, metal ion binding, phosphopantetheine binding, protein binding, acyl carrier activity.

cellular_component: mitochondrion.

biological_process: fatty acid biosynthetic process.

These properties come from reactome analysis


REACTOME_REACTION: NADH enters the respiratory chain at Complex I (REACT_6310).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393).

REACTOME_COMPLEX: HP subcomplex [mitochondrial inner membrane] (REACT_6454), Complex I - NADH:Ubiquinone oxidoreductase [mitochondrial inner membrane] (REACT_6533).

biological_process: respiratory electron transport chain.

These properties come from kegg analysis


molecular_function: NADH dehydrogenase (ubiquinone) activity, NADH dehydrogenase activity.

Locations

Located in CM3.5_scaffold00006 from 2128776 to 2130541.

This polypeptide in other databases

In PhylomeDB is Phy003LKKK_CUCME .

Related features