Polypeptide MELO3C006336P1

Accession: MELO3C006336P1

Name: MELO3C006336P1

Description: Similar to Probable voltage-gated potassium channel subunit beta (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q40648|KCAB_ORYSJ)

Sequence:

>MELO3C006336P1 Similar to Probable voltage-gated potassium channel subunit beta (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q40648|KCAB_ORYSJ)
MQYKNLGRSGLKVSQLSYGAWVSFGNQLDVREAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVS
TKIFWGGPGPNDKGLSRKHIVEGTKASLKRLDMEYVDVIYCHRPDSSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQIT
EAWGIADRLDLVGPIVEQPEYNLLSRHKVESEFLPLYNNYGIGLTTWSPLASGVLTGKYNKGSIPPDSRFALENYKNLAN
RSLVDDVLRKVNGLKPIADELGVPLSQLAIAWCAANPNVSSVITGATKESQIQENMKAVDVIPLLTPAVMEKIEAVVQSK
PKRPESFR*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Activation of voltage gated Potassium channels (REACT_75857).

REACTOME_PATHWAY: Voltage gated Potassium channels (REACT_75770), Potassium Channels (REACT_75908), Synaptic Transmission (REACT_13685).

REACTOME_COMPLEX: Octamer of Voltage gated K+ channels [plasma membrane] (REACT_76615).

biological_process: synaptic transmission.

These properties come from phylome analysis


molecular_function: oxidoreductase activity, voltage-gated ion channel activity, ion channel activity, aryl-alcohol dehydrogenase (NADP+) activity, voltage-gated potassium channel activity.

cellular_component: cytoplasm, plasma membrane.

biological_process: circadian sleep/wake cycle, sleep, flight behavior, oxidation-reduction process, transmembrane transport, potassium ion transport.

These properties come from blast2go analysis


molecular_function: aryl-alcohol dehydrogenase (NADP+) activity, voltage-gated potassium channel activity.

cellular_component: integral to membrane, plasma membrane, mitochondrion.

biological_process: oxidation-reduction process, transmembrane transport, potassium ion transport.

Locations

Located in CM3.5_scaffold00006 from 2634068 to 2637294.

This polypeptide in other databases

In PhylomeDB is Phy0039YSS_CUCME .

Related features