Polypeptide MELO3C006473P1
Accession: MELO3C006473P1
Name: MELO3C006473P1
Description: Similar to Predicted protein (Populus trichocarpa) (uniref90:UniRef90_B9HUM8)
Sequence:
>MELO3C006473P1 Similar to Predicted protein (Populus trichocarpa) (uniref90:UniRef90_B9HUM8) MFYEVELVRDVEITVEKEKRDAHNFQRYIITCLLENLLKEKANKDHGYFLSVTSLKSIGKGVVKNESQCVSFPITFICRT FLPFEGEILHGVVRHIFQRGLLLKCGPIKYAFLSARKMPTYQYVGGENPVFSSKEFATIGNDVVVRFSVLGVRWIEKRGC IKKEFVMLASLEGNNSLGPISLSDSDEFDL*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_PATHWAY: Formation of the Early Elongation Complex (REACT_101279), mRNA Capping (REACT_102770), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), Elongation arrest and recovery (REACT_1892), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_1941), Pausing and recovery of Tat-mediated HIV-1 elongation (REACT_6143), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34355), RNA Polymerase II Transcription Elongation (REACT_87946), RNA Pol II CTD phosphorylation and interaction with CE (REACT_90040), Abortive elongation of HIV-1 transcript in the absence of Tat (REACT_6261), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), Formation of the Early Elongation Complex (REACT_846), HIV Life Cycle (REACT_6256), HIV-1 elongation arrest and recovery (REACT_6259), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), Transcription-coupled NER (TC-NER) (REACT_29182), Transcription (REACT_87991), Transcription (REACT_1788), mRNA Capping (REACT_1470), mRNA Capping (REACT_85562), Transcription-coupled NER (TC-NER) (REACT_87141), RNA Polymerase II Pre-transcription Events (REACT_82727), Formation of the HIV-1 Early Elongation Complex (REACT_6319), Pausing and recovery of HIV-1 elongation (REACT_6244), mRNA Splicing - Major Pathway (REACT_93740), mRNA Splicing (REACT_107931), RNA Pol II CTD phosphorylation and interaction with CE (REACT_33716), RNA Polymerase II Transcription Elongation (REACT_81750), RNA Polymerase II Promoter Escape (REACT_107789), mRNA Splicing - Minor Pathway (REACT_101749), RNA Polymerase II Transcription (REACT_1366), DNA Repair (REACT_91442), mRNA Processing (REACT_1675), Formation of RNA Pol II elongation complex (REACT_1845), Transcription of the HIV genome (REACT_6233), RNA Pol II CTD phosphorylation and interaction with CE (REACT_6237), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_87559), HIV-1 Transcription Initiation (REACT_6332), RNA Pol II CTD phosphorylation and interaction with CE (REACT_975), mRNA Processing (REACT_80866), Formation and Maturation of mRNA Transcript (REACT_32779), DNA Repair (REACT_216), RNA Polymerase II Promoter Escape (REACT_2089), mRNA Splicing - Minor Pathway (REACT_1753), HIV Infection (REACT_6185), RNA Polymerase II Transcription Initiation (REACT_1851), Gene Expression (REACT_108313), RNA Polymerase II Pre-transcription Events (REACT_22107), Transcription (REACT_34268), Tat-mediated HIV-1 elongation arrest and recovery (REACT_6344), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Gene Expression (REACT_98256), Elongation arrest and recovery (REACT_79615), mRNA Splicing (REACT_1735), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_102536), Gene Expression (REACT_71), Pausing and recovery of elongation (REACT_83577), Dual incision reaction in TC-NER (REACT_81556), Pausing and recovery of elongation (REACT_769), Processing of Capped Intron-Containing Pre-mRNA (REACT_30593), RNA Polymerase II Transcription (REACT_99950), Nucleotide Excision Repair (REACT_88933), Nucleotide Excision Repair (REACT_1826), Nucleotide Excision Repair (REACT_84438), Late Phase of HIV Life Cycle (REACT_6361), Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), DNA Repair (REACT_93704), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_91566), Formation of the Early Elongation Complex (REACT_99528), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34737), Dual incision reaction in TC-NER (REACT_2222), Transcription-coupled NER (TC-NER) (REACT_1628), RNA Polymerase II Pre-transcription Events (REACT_82104), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), RNA Polymerase II Transcription Initiation (REACT_87429), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription (REACT_106213), RNA Polymerase II Promoter Escape (REACT_109274), RNA Polymerase II Transcription Elongation (REACT_833), Dual incision reaction in TC-NER (REACT_30923), mRNA Processing (REACT_90209), mRNA Splicing - Major Pathway (REACT_467), Formation and Maturation of mRNA Transcript (REACT_96378), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_83749), RNA Polymerase II Transcription Initiation (REACT_104646), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), HIV-1 Transcription Elongation (REACT_6274).
REACTOME_REACTION: RNA Polymerase II Promoter Opening: First Transition (REACT_29850), Formation of AT-AC B Complex (REACT_1253), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_1251), Formation of the Spliceosomal B Complex (REACT_48), Abortive Initiation After Second Transition (REACT_1793), Formation of the closed pre-initiation complex (REACT_82855), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Internal Methylation of mRNA (REACT_1720), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_1082), Phosphorylation (Ser5) of RNA pol II CTD (REACT_90675), Pol II elongation complex moves on the template as transcript elongates (REACT_2053), Abortive initiation after formation of the first phosphodiester bond (REACT_653), Fall Back to Closed Pre-initiation Complex (REACT_6211), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_1494), Abortive termination of HIV-1 elongation after arrest (Tat-containing elongation complex) (REACT_6269), Resumption of transcription after TC-NER (REACT_551), Activation of GT (REACT_103913), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_79829), Abortive HIV-1 Initiation After Second Transition (REACT_6265), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_2233), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_95548), Extrusion of 5-end of 30 nt long HIV-1 transcript through the pore in Pol II complex (REACT_6148), TFIIS-mediated recovery of HIV-1 elongation from arrest (REACT_6252), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_6250), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6254), RNA Polymerase II Promoter Opening: First Transition (REACT_94679), Abortive termination of early transcription elongation by DSIF:NELF (REACT_89590), Formation of the CE:GMP intermediate complex (REACT_90910), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_83079), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_802), NTP Binds Active Site of RNA Polymerase II (REACT_84849), Methylation of GMP-cap by RNA Methyltransferase (REACT_404), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_29457), Formation of active Pol II complex with lesioned DNA template (REACT_105740), TFIIS-mediated recovery of elongation from arrest (REACT_1094), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_1968), Separation of abortive HIV-1 transcript from template (REACT_6159), Pol II elongation complex moves on the HIV-1 template as transcript elongates (REACT_6158), Phosphorylation of NEFL by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6311), Phosphorylation of DSIF by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6316), Dissociation of transcript with 5-GMP from GT (REACT_30543), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_95240), Binding of TFIIE to the growing preinitiation complex (REACT_82447), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6155), Resumption of elongation after recovery from pausing (REACT_79713), Pol II elongation complex moves on the template as transcript elongates (REACT_30038), Addition of nucleotides between position +11 and +30 on HIV-1 transcript (REACT_6240), Capping complex formation (REACT_32400), Addition of nucleotides leads to transcript elongation (REACT_107064), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_97660), NTP Binds Active Site of RNA Polymerase II (REACT_86985), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_1567), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_234), Displacement of stalled Pol II from the lesion site (REACT_82387), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86649), Formation of pre-mRNPs (REACT_1877), Fall Back to Closed Pre-initiation Complex (REACT_1702), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_78922), Fall Back to Closed Pre-initiation Complex (REACT_92728), Formation of the closed pre-initiation complex (REACT_632), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_1368), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), Formation of the CE:GMP intermediate complex (REACT_1580), Dissociation of transcript with 5-GMP from GT (REACT_90647), Addition of nucleotides between position +11 and +30 (REACT_29713), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28433), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_110194), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Formation of AT-AC C complex (REACT_110048), Capping complex formation (REACT_85029), Formation of the Spliceosomal E complex (REACT_222), Displacement of stalled Pol II from the lesion site (REACT_1284), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_423), Formation of active Pol II complex with lesioned DNA template (REACT_97303), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_77594), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_1947), Abortive Initiation After Second Transition (REACT_108713), Phosphorylation (Ser5) of RNA pol II CTD (REACT_6234), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_2066), TFIIS-mediated recovery of elongation from arrest (REACT_6330), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), HIV-1 Promoter Opening: First Transition (REACT_6134), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_102861), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_88439), Activation of GT (REACT_893), Internal Methylation of mRNA (REACT_85125), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_2241), Formation of AT-AC B Complex (REACT_100957), Displacement of stalled Pol II from the lesion site (REACT_87615), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93340), Formation of active Pol II complex with lesioned DNA template (REACT_1453), Fall Back to Closed Pre-initiation Complex (REACT_31744), NTP Binds Active Site of RNA Polymerase II (REACT_1160), Addition of nucleotides leads to transcript elongation (REACT_751), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_6220), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_34550), Formation of AT-AC A complex (REACT_864), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6347), Recruitment of elongation factors to form elongation complex (REACT_949), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_93916), Methylation of GMP-cap by RNA Methyltransferase (REACT_34170), Activation of GT (REACT_6298), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6299), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_6297), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_6295), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_79518), Recognition and binding of the mRNA cap by the cap-binding complex (REACT_687), Addition of nucleotides between position +11 and +30 (REACT_209), Activation of GT (REACT_84234), Resumption of transcription after TC-NER (REACT_88101), Limited elongation of the HIV-1 transcript (REACT_6192), Abortive termination of HIV-1 early transcription elongation by DSIF:NELF (REACT_6281), Formation of AT-AC C complex (REACT_1615), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Binding of TFIIE to the growing preinitiation complex (REACT_78942), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6214), Assembly of repair proteins at the site of Pol II blockage (REACT_1584), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_86848), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_29917), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6358), Formation of DSIF:NELF:HIV-1 early elongation complex (REACT_6357), Abortive termination of elongation after arrest (REACT_6355), Abortive termination of HIV-1 elongation after arrest (REACT_6352), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331), Abortive Initiation After Second Transition (REACT_103180), TFIIS-mediated recovery of elongation from arrest (REACT_102520), Separation of elongating transcript from template (REACT_81515), Capping complex formation (REACT_2186), Formation of Exon Junction Complex (REACT_85923), Formation of the active Spliceosomal C complex (REACT_63591), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Elongating transcript encounters a lesion in the template (REACT_1138), Formation of the CE:GMP intermediate complex (REACT_79193), Formation of an intermediate Spliceosomal C complex (REACT_91565), Phosphorylation (Ser5) of RNA pol II CTD (REACT_1185), Abortive termination of elongation after arrest (REACT_98053), Formation of Exon Junction Complex (REACT_774), Addition of nucleotides 10 and 11 on the growing HIV-1 transcript: Third Transition (REACT_6208), Recognition and binding of the HIV-1 mRNA cap by the cap-binding complex (REACT_6166), Phosphorylation (Ser5) of RNA pol II CTD (REACT_91157), Formation of the closed pre-initiation complex (REACT_98407), Separation of elongating transcript from template (REACT_2030), Separation of elongating HIV-1 transcript from template (REACT_6204), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_6206), Formation of the Spliceosomal B Complex (REACT_109266), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_30335), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_34608), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_103987), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_33504), Resumption of transcription after TC-NER (REACT_29828), Abortive termination of early transcription elongation by DSIF:NELF (REACT_989), Formation of the active Spliceosomal C complex (REACT_1554), Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of DSIF:NELF:early elongation complex (REACT_981), 7-14 nt. Backtracking of Pol II complex on the template leading to elongation arrest (REACT_1645), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_81731), Resumption of elongation after recovery from pausing (REACT_1638), Formation of the Spliceosomal A Complex (REACT_788), Addition of nucleotides between position +11 and +30 (REACT_90076), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Hyperphosphorylation (Ser2) of RNA Pol II CTD by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6170), Addition of nucleotides leads to HIV-1 transcript elongation (REACT_6278), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6174), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6275), Abortive Initiation Before Second Transition (REACT_543), Dissociation of transcript with 5-GMP from GT (REACT_703).
REACTOME_COMPLEX: HIV-1 Tat-containing paused processive elongation complex [nucleoplasm] (REACT_6389), RNA Polymerase II (unphosphorylated):TFIIF complex [nucleoplasm] (REACT_2692), Capping complex (intermediate) [nucleoplasm] (REACT_3580), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), Capping complex (hydrolyzed) [nucleoplasm] (REACT_4969), HIV-1 transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_6664), Pol II transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_2595), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_3171), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), RNA Polymerase II holoenzyme complex (hyperphosphorylated) [nucleoplasm] (REACT_4889), Stalled Pol II complex with damaged DNA hybrid [nucleoplasm] (REACT_3072), Arrested processive elongation complex [nucleoplasm] (REACT_4675), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_6382), pol II transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_3183), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_6521), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_6659), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Aborted elongation complex after arrest [nucleoplasm] (REACT_6654), RNA Polymerase II holoenzyme complex (unphosphorylated) [nucleoplasm] (REACT_4217), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_2371), Spliceosomal A Complex [nucleoplasm] (REACT_4512), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD and phospho-NELF [nucleoplasm] (REACT_6495), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_6491), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Capping complex (with freed 5- GMP) [nucleoplasm] (REACT_4741), Elongation complex prior to separation [nucleoplasm] (REACT_5853), HIV-1 Tat-containing arrested processive elongation complex [nucleoplasm] (REACT_6532), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6536), Elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_5512), DSIF:NELF:early elongation complex after limited nucleotide addition [nucleoplasm] (REACT_6432), HIV-1 transcription complex [nucleoplasm] (REACT_6433), pol II transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_5212), Processive elongation complex [nucleoplasm] (REACT_3018), Stalled Pol II in TC-NER [nucleoplasm] (REACT_4443), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), Aborted early elongation complex [nucleoplasm] (REACT_3362), RNA polymerase II (phosphorylated):TFIIF complex [nucleoplasm] (REACT_4593), capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_3243), HIV-1 Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_6503), HIV-1 elongation complex [nucleoplasm] (REACT_6501), RNA Polymerase II holoenzyme complex (generic) [nucleoplasm] (REACT_12944), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_6426), ATAC C Complex with lariat containing 5-end cleaved mRNA [nucleoplasm] (REACT_5134), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD ( phospho-NELF phospho DSIF) [nucleoplasm] (REACT_6633), HIV-1 transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_6638), Capping complex (GpppN..) [nucleoplasm] (REACT_2312), Active Pol II complex with repaired DNA template:mRNA hybrid [nucleoplasm] (REACT_2462), Covalent CE:GMP intermediate complex [nucleoplasm] (REACT_2774), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 Tat-containing processive elongation complex [nucleoplasm] (REACT_6452), HIV-1 paused processive elongation complex [nucleoplasm] (REACT_6459), HIV-1 transcription complex containing transcript to +30 [nucleoplasm] (REACT_6514), HIV-1 transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_6516), pol II transcription complex [nucleoplasm] (REACT_2954), Spliceosomal E Complex [nucleoplasm] (REACT_4545), Tat-containing elongation complex prior to separation [nucleoplasm] (REACT_6548), ATAC A Complex [nucleoplasm] (REACT_4037), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_3928), Aborted HIV-1 early elongation complex [nucleoplasm] (REACT_6695), HIV-1 transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_6561), HIV-1 transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_6563), Capping complex (initial) [nucleoplasm] (REACT_4555), HIV-1 elongation complex containing Tat [nucleoplasm] (REACT_6611), Pol II initiation complex [nucleoplasm] (REACT_5487), Early elongation complex with separated aborted transcript [nucleoplasm] (REACT_6590), Pol II transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_4335), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_6594), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), Early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_2481), RNA Polymerase II holoenzyme complex (phosphorylated) [nucleoplasm] (REACT_5819), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), ATAC C Complex [nucleoplasm] (REACT_4626), P-TEFb(Cyclin T1:Cdk9)-containing elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_6686), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 processive elongation complex [nucleoplasm] (REACT_6579), HIV-1 aborted elongation complex after arrest [nucleoplasm] (REACT_6471), post exon ligation complex [nucleoplasm] (REACT_5793), RNA Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_3935), HIV-1 arrested processive elongation complex [nucleoplasm] (REACT_6609), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), Pol II transcription complex containing transcript to +30 [nucleoplasm] (REACT_4399), HIV-1 Tat-containing aborted elongation complex after arrest [nucleoplasm] (REACT_6602), capped, methylated pre-mRNA:CBC Complex [nucleoplasm] (REACT_3634), ATAC B Complex [nucleoplasm] (REACT_5095), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_4417), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_2332), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), RNA Polymearse II:NTP:TFIIF complex [nucleoplasm] (REACT_4655), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_5658), HIV-1 capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_6374), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), RNA Polymerase II holoenzyme complex (hyperphosphorylated):TFIIF complex [nucleoplasm] (REACT_3841), HIV-1 early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6467), Paused processive elongation complex [nucleoplasm] (REACT_3066), Exon Junction Complex [nucleoplasm] (REACT_2984), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_4575), Elongation complex [nucleoplasm] (REACT_3511), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), Active Pol II transcription complex with damaged DNA hybrid [nucleoplasm] (REACT_3609), capped, methylated pre-mRNP:CBC complex [nucleoplasm] (REACT_2736), RNA Polymerase II holoenzyme complex (hypophosphorylated):TFIIF complex [nucleoplasm] (REACT_5870).
biological_process: transcription-coupled nucleotide-excision repair, DNA repair, nucleotide-excision repair, nuclear mRNA splicing, via spliceosome, viral transcription, mRNA capping, transcription initiation from RNA polymerase II promoter, transcription from RNA polymerase II promoter, transcription elongation from RNA polymerase II promoter, positive regulation of viral transcription, RNA splicing, gene expression, viral reproduction.
These properties come from phylome analysis
molecular_function: DNA-directed RNA polymerase activity.
This polypeptide in other databases
In PhylomeDB is Phy0039ZQE_CUCME .

