Polypeptide MELO3C006615P1

Accession: MELO3C006615P1

Name: MELO3C006615P1

Description: Similar to RING finger and CHY zinc finger domain-containing protein 1 (Mus musculus) (uniprot_sprot:sp|Q9CR50|ZN363_MOUSE)

Sequence:

>MELO3C006615P1 Similar to RING finger and CHY zinc finger domain-containing protein 1 (Mus musculus) (uniprot_sprot:sp|Q9CR50|ZN363_MOUSE)
MRAFMEVSADDRLDFGKMGYGCQHYRRRCKIRAPCCNEIYPCRHCHNEATSVMSRLSDRHELNRFDVKQVVCAVCDTEQP
VARVCTNCGVNMGEYFCEICKFFDDDIEKGQFHCEDCGICRVGSREKYFHCKKCGSCYHVNLRDNHSCIENSMQHHCPIC
YEYLFDTLKDVSVMKCGHTMHLECYSEMISRDKYCCPICSKSVVDMSKAWKQLDEEIEATVMPEEYRHKKVWILCNDCND
TTEVYFHIIGQKCCHCQSYNTRAIAPPVLPQ*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: zinc ion binding, protein binding.

These properties come from reactome analysis


REACTOME_REACTION: Interaction of E3 with substrate and E2-Ub complex (REACT_75856), Transfer of Ub from E2 to substrate and release of E2 (REACT_75901), Release of E3 from polyubiquitinated substrate (REACT_75928).

REACTOME_PATHWAY: Adaptive Immunity Signaling (REACT_75774), Antigen processing: Ubiquitination & Proteasome degradation (REACT_75842), Immune System (REACT_6900), Class I MHC mediated antigen processing & presentation (REACT_75820).

REACTOME_COMPLEX: E3:Ub:substrate [cytosol] (REACT_76185), E3:K48-polyubiquitinated substrate [cytosol] (REACT_75972), Ag-substrate:E3:E2:Ub [cytosol] (REACT_76727).

biological_process: protein polyubiquitination, antigen processing and presentation of peptide antigen via MHC class I.

These properties come from phylome analysis


molecular_function: electron carrier activity, zinc ion binding, protein binding.

These properties come from kegg analysis


KEGG_ORTHOLOGS: ring finger and CHY zinc finger domain-containing protein 1 (K10144).

Locations

Located in CM3.5_scaffold00006 from 4591570 to 4593936.

This polypeptide in other databases

In PhylomeDB is Phy003ADXW_CUCME .

Related features