Polypeptide MELO3C006760P2

Accession: MELO3C006760P2

Name: MELO3C006760P2

Description: Similar to Chromatin structure-remodeling complex protein BSH (Arabidopsis thaliana) (uniprot_sprot:sp|P93045|BSH_ARATH)

Sequence:

>MELO3C006760P2 Similar to Chromatin structure-remodeling complex protein BSH (Arabidopsis thaliana) (uniprot_sprot:sp|P93045|BSH_ARATH)
MKASASPHSKAPFKFRIPTAENLVPIRLDIEIDGQRFKDAFTWNPSDPDSEVVVFAKRTVKDLKLPPAFITQIAQSIQSQ
LTEFRSFEGQDMYTGEKIIPIKLDLRVNNTIIKDQFLWDLNNYESDPEEFSRTLCKDLGIDDPEVGPAIAVAIREQLYEI
AVQNVASARESRMSKKGRRGFEHVPVSKTGGASVDLVKLFGHRSSVVRKRKDWDIYEPIVDLLSNEEVDALEAKEERIAR
*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (K11648).

These properties come from phylome analysis


molecular_function: SET domain binding, protein binding, p53 binding.

cellular_component: nBAF complex, npBAF complex, brahma complex, RSC complex, chromatin remodeling complex, SWI/SNF complex, nucleolus, nucleoplasm, nuclear chromosome.

biological_process: dendrite guidance, positive regulation of sequence-specific DNA binding transcription factor activity, dendrite morphogenesis, positive regulation of transcription from RNA polymerase II promoter, positive regulation of transcription, DNA-dependent, retroviral genome replication, interspecies interaction between organisms, ATP-dependent chromatin remodeling, hermaphrodite genitalia development, positive regulation of locomotion, positive regulation of growth rate, regulation of DNA replication involved in S phase, chromatin remodeling at centromere, oviposition, DNA integration, positive regulation of gene-specific transcription from RNA polymerase II promoter, embryo development ending in birth or egg hatching, imaginal disc-derived wing margin morphogenesis, imaginal disc-derived wing vein morphogenesis, epidermis development, negative regulation of cell proliferation, muscle organ development, imaginal disc-derived wing vein specification, nervous system development, chromosome segregation, cell cycle, receptor-mediated endocytosis, transcription elongation from RNA polymerase II promoter, transcription, DNA-dependent, nucleosome disassembly, double-strand break repair, nematode larval development, G2/M transition of mitotic cell cycle, regulation of transcription, DNA-dependent, chromatin remodeling.

These properties come from blast2go analysis


molecular_function: protein dimerization activity.

cellular_component: nuclear chromosome.

biological_process: auxin mediated signaling pathway, regulation of transcription, DNA-dependent, chromatin remodeling.

Locations

Located in CM3.5_scaffold00006 from 5745096 to 5750606.

This polypeptide in other databases

In PhylomeDB is Phy003AAK3_CUCME .

Related features