Polypeptide MELO3C006881P1
Accession: MELO3C006881P1
Name: MELO3C006881P1
Description: Similar to DNA-directed RNA polymerases I, II, and III subunit RPABC2 (Rattus norvegicus) (uniprot_sprot:sp|O88828|RPAB2_RAT)
Sequence:
>MELO3C006881P1 Similar to DNA-directed RNA polymerases I, II, and III subunit RPABC2 (Rattus norvegicus) (uniprot_sprot:sp|O88828|RPAB2_RAT) MPFVNLHEGLCPTSSIQYEDEPPEPEIEEGAEEELDNTNNDDITGEPVEAEEKEDEEPVERARKTSKFMTKYERARILGT RALQISMNAPVMVELEGETDPLEIAMKELRERKIPFTIRRYLPDGSYEDWGVDELIVEDSWKRQVGGA*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: DNA binding, DNA-directed RNA polymerase activity.
cellular_component: RNA polymerase complex.
biological_process: transcription, DNA-dependent.
These properties come from reactome analysis
REACTOME_PATHWAY: RNA Polymerase II Transcription (REACT_99228), Dual incision reaction in TC-NER (REACT_109190), RNA Polymerase III Transcription Initiation (REACT_89165), RNA Polymerase III Transcription Initiation (REACT_33287), RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription (REACT_106372), mRNA Splicing (REACT_94469), Formation of the Early Elongation Complex (REACT_101279), RNA Polymerase III Transcription Initiation From Type 2 Promoter (REACT_85004), mRNA Capping (REACT_102770), RNA Polymerase III Transcription (REACT_84770), RNA Polymerase III Transcription Initiation (REACT_94318), RNA Polymerase III Transcription Initiation From Type 1 Promoter (REACT_101904), RNA Polymerase III Transcription (REACT_91182), mRNA Splicing - Major Pathway (REACT_91611), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), DNA Repair (REACT_82907), RNA Pol II CTD phosphorylation and interaction with CE (REACT_96584), Elongation arrest and recovery (REACT_1892), RNA Polymerase III Abortive And Retractive Initiation (REACT_83735), RNA Polymerase III Transcription Initiation From Type 1 Promoter (REACT_109979), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_1941), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_78187), mRNA Splicing - Minor Pathway (REACT_101749), RNA Polymerase II Promoter Escape (REACT_32829), Pausing and recovery of Tat-mediated HIV-1 elongation (REACT_6143), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34355), RNA Pol II CTD phosphorylation and interaction with CE (REACT_90040), Abortive elongation of HIV-1 transcript in the absence of Tat (REACT_6261), mRNA Capping (REACT_85081), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), Formation of the Early Elongation Complex (REACT_846), HIV Life Cycle (REACT_6256), HIV-1 elongation arrest and recovery (REACT_6259), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), Transcription-coupled NER (TC-NER) (REACT_29182), RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription (REACT_102763), Transcription (REACT_87991), RNA Polymerase III Transcription Termination (REACT_84701), Transcription (REACT_1788), Gene Expression (REACT_85241), mRNA Capping (REACT_1470), mRNA Capping (REACT_81603), RNA Polymerase III Transcription Initiation From Type 2 Promoter (REACT_95797), RNA Pol II CTD phosphorylation and interaction with CE (REACT_30624), Transcription-coupled NER (TC-NER) (REACT_87141), RNA Polymerase III Transcription (REACT_92970), RNA Polymerase II Pre-transcription Events (REACT_82727), RNA Polymerase III Transcription Termination (REACT_79014), Formation of the HIV-1 Early Elongation Complex (REACT_6319), Pausing and recovery of HIV-1 elongation (REACT_6244), RNA Polymerase III Abortive And Retractive Initiation (REACT_99565), RNA Polymerase II Promoter Escape (REACT_81662), Gene Expression (REACT_91657), RNA Polymerase III Chain Elongation (REACT_33917), Elongation arrest and recovery (REACT_91132), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_109232), RNA Polymerase III Transcription (REACT_1371), mRNA Splicing - Major Pathway (REACT_93740), mRNA Splicing (REACT_107931), RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription (REACT_21352), DNA Repair (REACT_88201), Transcription (REACT_93622), RNA Pol II CTD phosphorylation and interaction with CE (REACT_33716), RNA Polymerase III Chain Elongation (REACT_33298), mRNA Capping (REACT_93735), RNA Polymerase II Transcription Elongation (REACT_81750), RNA Polymerase II Promoter Escape (REACT_107789), RNA Polymerase II Transcription (REACT_97471), Processing of Capped Intron-Containing Pre-mRNA (REACT_109442), mRNA Processing (REACT_109337), RNA Polymerase III Transcription Initiation From Type 2 Promoter (REACT_32666), RNA Polymerase II Transcription (REACT_1366), RNA Polymerase II Transcription Elongation (REACT_92836), RNA Polymerase II Transcription Initiation (REACT_104646), RNA Polymerase II Pre-transcription Events (REACT_91707), Formation and Maturation of mRNA Transcript (REACT_77979), Formation and Maturation of mRNA Transcript (REACT_92291), RNA Polymerase II Transcription Elongation (REACT_94090), RNA Polymerase III Transcription Initiation From Type 1 Promoter (REACT_347), mRNA Splicing (REACT_81581), DNA Repair (REACT_91442), mRNA Processing (REACT_1675), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_85257), Formation of RNA Pol II elongation complex (REACT_1845), mRNA Splicing (REACT_98879), RNA Polymerase III Transcription Initiation (REACT_102986), Transcription of the HIV genome (REACT_6233), mRNA Capping (REACT_85562), RNA Pol II CTD phosphorylation and interaction with CE (REACT_6237), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_87559), HIV-1 Transcription Initiation (REACT_6332), RNA Pol II CTD phosphorylation and interaction with CE (REACT_975), RNA Polymerase II Promoter Escape (REACT_106149), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_86892), RNA Polymerase III Transcription Termination (REACT_86112), RNA Polymerase III Abortive And Retractive Initiation (REACT_78758), RNA Polymerase III Transcription Initiation From Type 3 Promoter (REACT_33164), mRNA Processing (REACT_80866), Formation and Maturation of mRNA Transcript (REACT_32779), Formation of the Early Elongation Complex (REACT_97522), DNA Repair (REACT_216), RNA Polymerase II Promoter Escape (REACT_2089), RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription (REACT_33462), mRNA Splicing - Minor Pathway (REACT_1753), HIV Infection (REACT_6185), RNA Polymerase II Transcription Initiation (REACT_1851), Gene Expression (REACT_108313), RNA Polymerase II Pre-transcription Events (REACT_22107), Transcription (REACT_34268), RNA Polymerase III Chain Elongation (REACT_756), RNA Polymerase III Transcription Initiation (REACT_94057), Tat-mediated HIV-1 elongation arrest and recovery (REACT_6344), Nucleotide Excision Repair (REACT_106982), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Processing of Capped Intron-Containing Pre-mRNA (REACT_30593), mRNA Splicing - Minor Pathway (REACT_88186), RNA Polymerase III Abortive And Retractive Initiation (REACT_33938), RNA Polymerase II Transcription Elongation (REACT_107633), Elongation arrest and recovery (REACT_79615), mRNA Splicing (REACT_1735), RNA Polymerase II Transcription Initiation (REACT_105389), Transcription-coupled NER (TC-NER) (REACT_29721), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_102536), Gene Expression (REACT_71), Pausing and recovery of elongation (REACT_83577), Dual incision reaction in TC-NER (REACT_81556), RNA Polymerase III Chain Elongation (REACT_78831), mRNA Splicing - Minor Pathway (REACT_101135), RNA Polymerase III Chain Elongation (REACT_104942), Transcription (REACT_100899), Dual incision reaction in TC-NER (REACT_94657), RNA Polymerase II Pre-transcription Events (REACT_99660), Gene Expression (REACT_105649), RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription (REACT_103007), Pausing and recovery of elongation (REACT_769), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), Gene Expression (REACT_98256), RNA Polymerase III Transcription Initiation (REACT_281), RNA Pol II CTD phosphorylation and interaction with CE (REACT_28314), mRNA Processing (REACT_29019), RNA Polymerase II Transcription (REACT_99950), RNA Polymerase III Transcription Termination (REACT_104517), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_28862), Nucleotide Excision Repair (REACT_88933), Nucleotide Excision Repair (REACT_1826), Nucleotide Excision Repair (REACT_84438), Nucleotide Excision Repair (REACT_77033), DNA Repair (REACT_107446), RNA Polymerase II Transcription Initiation (REACT_104036), RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription (REACT_106642), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase III Abortive And Retractive Initiation (REACT_22339), RNA Polymerase II Transcription Initiation (REACT_88340), RNA Polymerase III Transcription Initiation From Type 2 Promoter (REACT_1036), Dual incision reaction in TC-NER (REACT_91002), RNA Polymerase III Transcription Termination (REACT_63), RNA Polymerase III Transcription Termination (REACT_97380), RNA Polymerase II Transcription (REACT_89454), Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_91566), DNA Repair (REACT_93704), Formation of the Early Elongation Complex (REACT_99528), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34737), Dual incision reaction in TC-NER (REACT_2222), Transcription-coupled NER (TC-NER) (REACT_1628), Transcription (REACT_99758), RNA Polymerase III Transcription Initiation From Type 2 Promoter (REACT_97189), RNA Polymerase II Pre-transcription Events (REACT_82104), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), RNA Polymerase II Pre-transcription Events (REACT_91410), RNA Polymerase II Transcription Initiation (REACT_87429), Formation of the Early Elongation Complex (REACT_29380), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription (REACT_106213), RNA Polymerase II Transcription Elongation (REACT_87946), RNA Polymerase II Promoter Escape (REACT_109274), RNA Polymerase III Transcription (REACT_79230), RNA Polymerase III Transcription Initiation From Type 3 Promoter (REACT_571), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_98915), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_79444), RNA Polymerase II Transcription Elongation (REACT_833), RNA Polymerase III Transcription (REACT_107815), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_88014), Dual incision reaction in TC-NER (REACT_30923), mRNA Processing (REACT_94551), Nucleotide Excision Repair (REACT_96106), mRNA Processing (REACT_90209), mRNA Splicing - Major Pathway (REACT_467), Transcription-coupled NER (TC-NER) (REACT_93719), Pausing and recovery of elongation (REACT_111024), RNA Polymerase III Abortive And Retractive Initiation (REACT_90206), Formation and Maturation of mRNA Transcript (REACT_96378), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_83749), Formation and Maturation of mRNA Transcript (REACT_85219), mRNA Splicing - Minor Pathway (REACT_91088), RNA Polymerase III Transcription Initiation From Type 2 Promoter (REACT_90709), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_83742), Formation of the Early Elongation Complex (REACT_84349), Transcription-coupled NER (TC-NER) (REACT_96116), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), RNA Polymerase III Chain Elongation (REACT_83012), HIV-1 Transcription Elongation (REACT_6274), Processing of Capped Intron-Containing Pre-mRNA (REACT_31128).
REACTOME_REACTION: RNA Polymerase II Promoter Opening: First Transition (REACT_29850), RNA Polymerase III Abortive Initiation At Type 2 Open Promoters (REACT_30852), Pol II elongation complex moves on the template as transcript elongates (REACT_30284), Formation of AT-AC B Complex (REACT_1253), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_1251), Formation of the Spliceosomal B Complex (REACT_48), Phosphorylation (Ser5) of RNA pol II CTD (REACT_31984), RNA Polymerase III Promoter Opening at Type 1 Promoters (REACT_796), RNA Polymerase III Promoter Opening at Type 2 Promoters (REACT_793), Phosphorylation (Ser5) of RNA pol II CTD (REACT_90675), Abortive initiation after formation of the first phosphodiester bond (REACT_653), Resumption of transcription after TC-NER (REACT_551), Internal Methylation of mRNA (REACT_85125), TFIIS-mediated recovery of HIV-1 elongation from arrest (REACT_6252), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_6250), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6254), Formation of the CE:GMP intermediate complex (REACT_90910), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_83079), RNA Polymerase III Termination and release of transcribed mRNA (REACT_101346), RNA Polymerase II Promoter Opening: First Transition (REACT_94679), Separation of abortive HIV-1 transcript from template (REACT_6159), Pol II elongation complex moves on the HIV-1 template as transcript elongates (REACT_6158), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6155), Pol II elongation complex moves on the template as transcript elongates (REACT_30038), RNA Polymerase III Termination and release of transcribed mRNA (REACT_878), Recruitment of RNA Polymerase III to the TFIIIB:TFIIIC: Type 2 Promoter Complex (REACT_1779), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_234), Formation of pre-mRNPs (REACT_1877), Fall Back to Closed Pre-initiation Complex (REACT_1702), TFIIS-mediated recovery of elongation from arrest (REACT_101748), RNA Polymerase III Simple Start Sequence Initiation At Type 2 Promoters (REACT_2178), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_100344), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), RNA Polymerase III Initiation At a Simple Start Sequence (REACT_1686), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Formation of AT-AC C complex (REACT_110048), Capping complex formation (REACT_85029), RNA Polymerase III Productive Transcription (REACT_2251), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_423), Initiation of RNA Polymerase III Productive Transcription (REACT_1179), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_77594), RNA Polymerase III Promoter Opening at Type 2 Promoters (REACT_77957), RNA Polymerase III Abortive Initiation At Type 1 Open Promoters (REACT_31708), Formation of the closed pre-initiation complex (REACT_105039), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), RNA Polymerase III Promoter Opening at Type 2 Promoters (REACT_109940), Formation of active Pol II complex with lesioned DNA template (REACT_1453), Initiation of RNA Polymerase III Productive Transcription (REACT_109938), Fall Back to Closed Pre-initiation Complex (REACT_31744), RNA Polymerase III Promoter Opening at Type 1 Promoters (REACT_109934), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_34550), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Resumption of transcription after TC-NER (REACT_80496), Activation of GT (REACT_6298), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6299), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_6297), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_6295), Activation of GT (REACT_103525), Resumption of transcription after TC-NER (REACT_88101), Dissociation of transcript with 5-GMP from GT (REACT_90647), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_99814), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_90318), RNA Polymerase III Transcriptional Pause at Terminator Sequence (REACT_91385), Addition of nucleotides between position +11 and +30 (REACT_29713), Abortive Initiation After Second Transition (REACT_103184), Abortive Initiation After Second Transition (REACT_103180), Initiation of RNA Polymerase III Productive Transcription (REACT_90945), RNA Polymerase III Simple Start Sequence Initiation At Type 1 Promoters (REACT_103226), Separation of elongating transcript from template (REACT_81515), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_78922), RNA Polymerase III Promoter Opening at Type 2 Promoters (REACT_103737), Displacement of stalled Pol II from the lesion site (REACT_28718), RNA Polymerase III Productive Transcription (REACT_98770), Formation of Exon Junction Complex (REACT_85923), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_92765), Recognition and binding of the HIV-1 mRNA cap by the cap-binding complex (REACT_6166), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_85925), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Separation of elongating HIV-1 transcript from template (REACT_6204), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_6206), Abortive termination of early transcription elongation by DSIF:NELF (REACT_87802), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_34608), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_103987), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_100578), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_88577), 7-14 nt. Backtracking of Pol II complex on the template leading to elongation arrest (REACT_1645), Resumption of elongation after recovery from pausing (REACT_1638), Phosphorylation (Ser5) of RNA pol II CTD (REACT_77857), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86674), Formation of AT-AC B Complex (REACT_101559), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_84917), RNA Polymerase II Promoter Opening: First Transition (REACT_80107), Formation of the CE:GMP intermediate complex (REACT_101635), Internal Methylation of mRNA (REACT_30916), Formation of the closed pre-initiation complex (REACT_82855), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), RNA Polymerase III Simple Start Sequence Initiation At Type 1 Promoters (REACT_2210), Addition of nucleotides 10 and 11 on the growing HIV-1 transcript: Third Transition (REACT_6208), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_1082), RNA Polymerase III Simple Start Sequence Initiation At Type 2 Promoters (REACT_109747), RNA Polymerase III Termination and release of transcribed mRNA (REACT_30092), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_1494), Activation of GT (REACT_103913), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_79829), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_95548), RNA Polymerase III Abortive Initiation At Type 2 Open Promoters (REACT_1061), RNA Polymerase III Termination and release of transcribed mRNA (REACT_1301), Resumption of transcription after TC-NER (REACT_29828), Methylation of GMP-cap by RNA Methyltransferase (REACT_97945), Dissociation of transcript with 5-GMP from GT (REACT_87469), Internal Methylation of mRNA (REACT_101890), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28192), Separation of elongating transcript from template (REACT_2030), Capping complex formation (REACT_32400), Formation of active Pol II complex with lesioned DNA template (REACT_96240), RNA Polymerase III Retractive RNase Activity at U-tract Pause Sites (REACT_80924), RNA Polymerase III Promoter Opening at Type 2 Promoters (REACT_81290), Dissociation of transcript with 5-GMP from GT (REACT_30543), Resumption of elongation after recovery from pausing (REACT_79713), Addition of nucleotides between position +11 and +30 on HIV-1 transcript (REACT_6240), Dissociation of transcript with 5-GMP from GT (REACT_101219), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_88546), Addition of nucleotides leads to transcript elongation (REACT_107064), NTP Binds Active Site of RNA Polymerase II (REACT_86985), Internal Methylation of mRNA (REACT_28726), Formation of the Spliceosomal B Complex (REACT_109266), Formation of Exon Junction Complex (REACT_92827), Capping complex formation (REACT_2186), Fall Back to Closed Pre-initiation Complex (REACT_92728), Formation of the closed pre-initiation complex (REACT_632), RNA Polymerase III Abortive Initiation At Type 1 Open Promoters (REACT_1241), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28433), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_110194), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_108808), Formation of the Spliceosomal E complex (REACT_222), Formation of AT-AC C complex (REACT_78819), Formation of active Pol II complex with lesioned DNA template (REACT_97303), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Phosphorylation (Ser5) of RNA pol II CTD (REACT_6234), RNA Polymerase III Transcriptional Pause at Terminator Sequence (REACT_2064), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_2066), TFIIS-mediated recovery of elongation from arrest (REACT_6330), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_102861), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_88434), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_81891), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_88439), Activation of GT (REACT_893), RNA Polymerase III Retractive RNase Activity at U-tract Pause Sites (REACT_2248), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_2241), RNA Polymerase III Termination and release of transcribed mRNA (REACT_95372), RNA Polymerase III Retractive RNase Activity at U-tract Pause Sites (REACT_110354), Addition of nucleotides leads to transcript elongation (REACT_751), NTP Binds Active Site of RNA Polymerase II (REACT_1160), Methylation of GMP-cap by RNA Methyltransferase (REACT_96650), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_77961), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_101583), Formation of AT-AC A complex (REACT_864), Recruitment of elongation factors to form elongation complex (REACT_949), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561), Phosphorylation (Ser5) of RNA pol II CTD (REACT_1185), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_81096), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_105023), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_105022), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_99299), Recognition and binding of the mRNA cap by the cap-binding complex (REACT_687), Limited elongation of the HIV-1 transcript (REACT_6192), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Dissociation of transcript with 5-GMP from GT (REACT_106203), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_86848), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_81825), RNA Polymerase III Abortive Initiation (REACT_616), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331), Abortive termination of HIV-1 early transcription elongation by DSIF:NELF (REACT_6281), Binding of TFIIE to the growing preinitiation complex (REACT_32367), Formation of the active Spliceosomal C complex (REACT_63591), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Abortive termination of early transcription elongation by DSIF:NELF (REACT_86233), Formation of AT-AC B Complex (REACT_90655), RNA Polymerase III Simple Start Sequence Initiation At Type 2 Promoters (REACT_106059), Formation of Exon Junction Complex (REACT_774), Displacement of stalled Pol II from the lesion site (REACT_108076), Abortive Initiation Before Second Transition (REACT_106763), Recruitment of RNA Polymerase III to the TFIIIB:TFIIIC: Type 2 Promoter Complex (REACT_34724), Resumption of RNA Polymerase III Productive Transcription (REACT_93305), Abortive Initiation Before Second Transition (REACT_543), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_108201), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Hyperphosphorylation (Ser2) of RNA Pol II CTD by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6170), Addition of nucleotides leads to HIV-1 transcript elongation (REACT_6278), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6174), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6275), Recruitment of RNA polymerase III to TFIIIB:TFIIIC:TFIIIA:Type 1 Promoter Complex (REACT_704), Dissociation of transcript with 5-GMP from GT (REACT_703), RNA Polymerase II Promoter Opening: First Transition (REACT_93391), RNA Polymerase III Abortive Initiation At Type 2 Open Promoters (REACT_103445), Resumption of RNA Polymerase III Productive Transcription (REACT_109350), Abortive Initiation After Second Transition (REACT_1793), RNA Polymerase III Simple Start Sequence Initiation At Type 3 Promoters (REACT_251), Recruitment of RNA Polymerase III to TFIIIB:SNAPc:Type 3 Promoter Complex (REACT_254), Formation of active Pol II complex with lesioned DNA template (REACT_89270), Internal Methylation of mRNA (REACT_1720), Pol II elongation complex moves on the template as transcript elongates (REACT_2053), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_77279), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_29457), Formation of the CE:GMP intermediate complex (REACT_79193), RNA Polymerase III Simple Start Sequence Initiation At Type 2 Promoters (REACT_106571), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_94470), Fall Back to Closed Pre-initiation Complex (REACT_98220), RNA Polymerase III Productive Transcription (REACT_89159), Formation of the Spliceosomal B Complex (REACT_90182), Methylation of GMP-cap by RNA Methyltransferase (REACT_404), Binding of TFIIE to the growing preinitiation complex (REACT_78942), Formation of active Pol II complex with lesioned DNA template (REACT_105740), TFIIS-mediated recovery of elongation from arrest (REACT_1094), Binding of TFIIE to the growing preinitiation complex (REACT_82447), Resumption of RNA Polymerase III Productive Transcription (REACT_1374), Resumption of RNA Polymerase III Productive Transcription (REACT_96798), Resumption of transcription after TC-NER (REACT_101665), Displacement of stalled Pol II from the lesion site (REACT_82387), Initiation of RNA Polymerase III Productive Transcription (REACT_109134), Recruitment of RNA polymerase III to TFIIIB:TFIIIC:TFIIIA:Type 1 Promoter Complex (REACT_108403), RNA Polymerase III Promoter Opening (REACT_1202), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_29917), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6358), RNA Polymerase III Retractive RNase Activity at U-tract Pause Sites (REACT_103091), Separation of elongating transcript from template (REACT_34213), RNA Polymerase III Retractive RNase Activity at U-tract Pause Sites (REACT_170), Resumption of RNA Polymerase III Productive Transcription (REACT_94753), Fall Back to Closed Pre-initiation Complex (REACT_86577), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_32792), Resumption of elongation after recovery from pausing (REACT_99936), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_1947), Abortive Initiation After Second Transition (REACT_108713), Formation of the closed pre-initiation complex (REACT_98407), Formation of an intermediate Spliceosomal C complex (REACT_625), HIV-1 Promoter Opening: First Transition (REACT_6134), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_86293), Formation of AT-AC B Complex (REACT_93825), Formation of AT-AC B Complex (REACT_100957), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_103482), RNA Polymerase III Productive Transcription (REACT_93041), Addition of nucleotides between position +11 and +30 (REACT_28303), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93340), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_6220), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Formation of the CE:GMP intermediate complex (REACT_110689), Addition of nucleotides between position +11 and +30 (REACT_28970), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6347), Methylation of GMP-cap by RNA Methyltransferase (REACT_93915), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_93916), Formation of the active Spliceosomal C complex (REACT_89446), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_79518), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_2233), RNA Polymerase III Abortive Initiation At Type 3 Open Promoters (REACT_1616), Formation of AT-AC C complex (REACT_1615), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_85239), Assembly of repair proteins at the site of Pol II blockage (REACT_1584), Formation of the CE:GMP intermediate complex (REACT_1580), Addition of nucleotides between position +11 and +30 (REACT_77879), RNA Polymerase III Abortive Initiation At Type 2 Open Promoters (REACT_106447), Elongating transcript encounters a lesion in the template (REACT_1138), RNA Polymerase III Transcriptional Pause at Terminator Sequence (REACT_31153), RNA Polymerase III Termination and release of transcribed mRNA (REACT_76992), NTP Binds Active Site of RNA Polymerase II (REACT_80120), Formation of an intermediate Spliceosomal C complex (REACT_91565), Abortive termination of early transcription elongation by DSIF:NELF (REACT_89590), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_82574), Fall Back to Closed Pre-initiation Complex (REACT_100253), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_30335), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_33504), Capping complex formation (REACT_91663), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93493), Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Formation of the Spliceosomal A Complex (REACT_788), Formation of the closed pre-initiation complex (REACT_83351), Abortive initiation after formation of the first phosphodiester bond (REACT_32630), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86649), Phosphorylation (Ser5) of RNA pol II CTD (REACT_88766), RNA Polymerase III Retractive RNase Activity at U-tract Pause Sites (REACT_93262), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_110236), Abortive termination of HIV-1 elongation after arrest (Tat-containing elongation complex) (REACT_6269), Abortive HIV-1 Initiation After Second Transition (REACT_6265), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_34583), Extrusion of 5-end of 30 nt long HIV-1 transcript through the pore in Pol II complex (REACT_6148), Formation of the closed pre-initiation complex (REACT_91116), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_102473), NTP Binds Active Site of RNA Polymerase II (REACT_84849), Formation of AT-AC C complex (REACT_83124), Phosphorylation of NEFL by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6311), Phosphorylation of DSIF by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6316), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_95240), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_103685), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_97660), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_81068), Activation of GT (REACT_96305), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_1567), Initiation of RNA Polymerase III Productive Transcription (REACT_99492), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_1968), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_1368), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_33423), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_87062), Abortive termination of elongation after arrest (REACT_95584), Displacement of stalled Pol II from the lesion site (REACT_1284), RNA Polymerase III Transcriptional Pause at Terminator Sequence (REACT_82930), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_30549), Formation of an intermediate Spliceosomal C complex (REACT_108009), Beginning of RNA Polymerase III Productive Transcription (REACT_1217), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_103086), Capping complex formation (REACT_86608), Displacement of stalled Pol II from the lesion site (REACT_103124), Displacement of stalled Pol II from the lesion site (REACT_87615), NTP Binds Active Site of RNA Polymerase II (REACT_106132), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_29681), Resumption of transcription after TC-NER (REACT_94622), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), Methylation of GMP-cap by RNA Methyltransferase (REACT_34170), Abortive termination of elongation after arrest (REACT_98053), Phosphorylation (Ser5) of RNA pol II CTD (REACT_91157), Formation of DSIF:NELF:early elongation complex (REACT_96991), RNA Polymerase III Abortive Initiation At Type 2 Open Promoters (REACT_90817), Addition of nucleotides between position +11 and +30 (REACT_209), RNA Polymerase III Productive Transcription (REACT_93859), Activation of GT (REACT_84234), Formation of active Pol II complex with lesioned DNA template (REACT_28257), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_104426), Capping complex formation (REACT_77633), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6214), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Fall Back to Closed Pre-initiation Complex (REACT_6211), Formation of DSIF:NELF:HIV-1 early elongation complex (REACT_6357), Abortive termination of elongation after arrest (REACT_6355), Abortive termination of HIV-1 elongation after arrest (REACT_6352), RNA Polymerase II Promoter Opening: First Transition (REACT_89694), Addition of nucleotides leads to transcript elongation (REACT_100466), TFIIS-mediated recovery of elongation from arrest (REACT_102520), RNA Polymerase III Transcriptional Pause at Terminator Sequence (REACT_84752), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_29379), Formation of the CE:GMP intermediate complex (REACT_92552), RNA Polymerase III Transcriptional Pause at Terminator Sequence (REACT_473), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_96127), RNA Polymerase III Simple Start Sequence Initiation At Type 2 Promoters (REACT_97026), Formation of AT-AC C complex (REACT_95722), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_802), NTP Binds Active Site of RNA Polymerase II (REACT_80520), Abortive termination of early transcription elongation by DSIF:NELF (REACT_989), Activation of GT (REACT_106797), Formation of the active Spliceosomal C complex (REACT_1554), Formation of DSIF:NELF:early elongation complex (REACT_981), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_109877), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_81731), RNA Polymerase III Promoter Opening at Type 3 Promoters (REACT_1485), Addition of nucleotides between position +11 and +30 (REACT_90076).
REACTOME_COMPLEX: HIV-1 Tat-containing paused processive elongation complex [nucleoplasm] (REACT_6389), RNA Polymerase II (unphosphorylated):TFIIF complex [nucleoplasm] (REACT_2692), Capping complex (intermediate) [nucleoplasm] (REACT_3580), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), Capping complex (hydrolyzed) [nucleoplasm] (REACT_4969), HIV-1 transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_6664), Pol II transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_2595), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_3171), RNA Polymerase III Open SUP4 tRNATyr Promoter Complex [nucleoplasm] (REACT_4509), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), RNA Polymerase II holoenzyme complex (hyperphosphorylated) [nucleoplasm] (REACT_4889), Stalled Pol II complex with damaged DNA hybrid [nucleoplasm] (REACT_3072), Arrested processive elongation complex [nucleoplasm] (REACT_4675), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_6382), pol II transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_3183), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_6521), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), RNA Polymerase III Holoenzyme [nucleoplasm] (REACT_4184), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_6659), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Aborted elongation complex after arrest [nucleoplasm] (REACT_6654), RNA Polymerase II holoenzyme complex (unphosphorylated) [nucleoplasm] (REACT_4217), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_2371), Spliceosomal A Complex [nucleoplasm] (REACT_4512), Paused RNA Polymerase III Transcription Complex [nucleoplasm] (REACT_5042), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_6491), RNA polymerase III:TFIIIB:TFIIIC:TFIIIA:Type 1 Promoter Complex [nucleoplasm] (REACT_2997), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Capping complex (with freed 5- GMP) [nucleoplasm] (REACT_4741), Elongation complex prior to separation [nucleoplasm] (REACT_5853), HIV-1 Tat-containing arrested processive elongation complex [nucleoplasm] (REACT_6532), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6536), Elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_5512), DSIF:NELF:early elongation complex after limited nucleotide addition [nucleoplasm] (REACT_6432), HIV-1 transcription complex [nucleoplasm] (REACT_6433), RNA Polymerase III SUP4 tRNATyr gene Transcription Complex [nucleoplasm] (REACT_2261), pol II transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_5212), Processive elongation complex [nucleoplasm] (REACT_3018), Stalled Pol II in TC-NER [nucleoplasm] (REACT_4443), RNA Polymerase III:TFIIIB:TFIIIC:Type 2 Open Promoter Complex [nucleoplasm] (REACT_3405), RNA Polymerase III Holoenzyme [nucleoplasm] (REACT_4447), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), Aborted early elongation complex [nucleoplasm] (REACT_3362), RNA polymerase II (phosphorylated):TFIIF complex [nucleoplasm] (REACT_4593), capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_3243), HIV-1 Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_6503), HIV-1 elongation complex [nucleoplasm] (REACT_6501), RNA Polymerase II holoenzyme complex (generic) [nucleoplasm] (REACT_12944), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_6426), ATAC C Complex with lariat containing 5-end cleaved mRNA [nucleoplasm] (REACT_5134), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD ( phospho-NELF phospho DSIF) [nucleoplasm] (REACT_6633), HIV-1 transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_6638), Capping complex (GpppN..) [nucleoplasm] (REACT_2312), Active Pol II complex with repaired DNA template:mRNA hybrid [nucleoplasm] (REACT_2462), Covalent CE:GMP intermediate complex [nucleoplasm] (REACT_2774), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 Tat-containing processive elongation complex [nucleoplasm] (REACT_6452), HIV-1 paused processive elongation complex [nucleoplasm] (REACT_6459), HIV-1 transcription complex containing transcript to +30 [nucleoplasm] (REACT_6514), HIV-1 transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_6516), pol II transcription complex [nucleoplasm] (REACT_2954), Elongating RNA Polymerase III Transcription Complex [nucleoplasm] (REACT_4544), Spliceosomal E Complex [nucleoplasm] (REACT_4545), Tat-containing elongation complex prior to separation [nucleoplasm] (REACT_6548), ATAC A Complex [nucleoplasm] (REACT_4037), RNA Polymerase III Closed SUP4 tRNATyr Promoter Complex [nucleoplasm] (REACT_5808), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_3928), Aborted HIV-1 early elongation complex [nucleoplasm] (REACT_6695), HIV-1 transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_6561), HIV-1 transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_6563), Capping complex (initial) [nucleoplasm] (REACT_4555), RNA Polymerase III:TFIIIB:SNAPc:Type 3 Open Promoter Complex [nucleoplasm] (REACT_4790), HIV-1 elongation complex containing Tat [nucleoplasm] (REACT_6611), Pol II initiation complex [nucleoplasm] (REACT_5487), Early elongation complex with separated aborted transcript [nucleoplasm] (REACT_6590), Pol II transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_4335), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_6594), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), Early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_2481), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD and phospho-NELF [nucleoplasm] (REACT_6495), RNA Polymerase II holoenzyme complex (phosphorylated) [nucleoplasm] (REACT_5819), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), ATAC C Complex [nucleoplasm] (REACT_4626), P-TEFb(Cyclin T1:Cdk9)-containing elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_6686), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 processive elongation complex [nucleoplasm] (REACT_6579), HIV-1 aborted elongation complex after arrest [nucleoplasm] (REACT_6471), post exon ligation complex [nucleoplasm] (REACT_5793), RNA polymerase III:TFIIIB:TFIIIC:TFIIIA:Type 1 Open Promoter Complex [nucleoplasm] (REACT_2429), RNA Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_3935), HIV-1 arrested processive elongation complex [nucleoplasm] (REACT_6609), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), Pol II transcription complex containing transcript to +30 [nucleoplasm] (REACT_4399), HIV-1 Tat-containing aborted elongation complex after arrest [nucleoplasm] (REACT_6602), capped, methylated pre-mRNA:CBC Complex [nucleoplasm] (REACT_3634), ATAC B Complex [nucleoplasm] (REACT_5095), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_4417), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_2332), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), RNA Polymearse II:NTP:TFIIF complex [nucleoplasm] (REACT_4655), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_5658), RNA Polymerase III:TFIIIB:TFIIIC:Type 2 Promoter Complex [nucleoplasm] (REACT_5655), HIV-1 capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_6374), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), RNA Polymerase II holoenzyme complex (hyperphosphorylated):TFIIF complex [nucleoplasm] (REACT_3841), HIV-1 early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6467), Paused processive elongation complex [nucleoplasm] (REACT_3066), RNA Polymerase III:TFIIIB:SNAPc:Type 3 Promoter Complex [nucleoplasm] (REACT_3694), Exon Junction Complex [nucleoplasm] (REACT_2984), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_4575), RNA Polymerase III Terminator Paused Complex [nucleoplasm] (REACT_4574), Elongation complex [nucleoplasm] (REACT_3511), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), Active Pol II transcription complex with damaged DNA hybrid [nucleoplasm] (REACT_3609), capped, methylated pre-mRNP:CBC complex [nucleoplasm] (REACT_2736), RNA Polymerase II holoenzyme complex (hypophosphorylated):TFIIF complex [nucleoplasm] (REACT_5870).
biological_process: termination of RNA polymerase III transcription, transcription elongation from RNA polymerase III promoter, transcription from RNA polymerase III promoter, transcription-coupled nucleotide-excision repair, DNA repair, nucleotide-excision repair, nuclear mRNA splicing, via spliceosome, viral transcription, mRNA capping, transcription initiation from RNA polymerase II promoter, transcription from RNA polymerase II promoter, transcription elongation from RNA polymerase II promoter, positive regulation of viral transcription, RNA splicing, gene expression, viral reproduction.
These properties come from kegg analysis
KEGG_REACTION: ATP:polynucleotide (R00435), GTP:RNA (R00441), CTP:RNA (R00442), UTP:RNA (R00443).
molecular_function: DNA-directed RNA polymerase activity.
COG: DNA-directed RNA polymerase, subunit K/omega (COG1758).
This polypeptide in other databases
In PhylomeDB is Phy003LLRP_CUCME .