Polypeptide MELO3C008127P1
Accession: MELO3C008127P1
Name: MELO3C008127P1
Description: Similar to Protein disulfide-isomerase 5-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q94F09|PDI52_ARATH)
Sequence:
>MELO3C008127P1 Similar to Protein disulfide-isomerase 5-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q94F09|PDI52_ARATH) MRRSWQFLVLFLLSISALPSFSLSSSELPLTADGKVLDLDESNFDLAISSFDYILVDFYAPWCGHCKRLSPELDAAAPQL ARLKEPIVLAKVNADKYTSLAKKYDVDAYPTIKIFMHGVPVDYYGPRKAELLARYLKKFVAPDVSVLESDSSINEFVEAA GPYFPIYLGFGLDESVISKFEPFLEEFIKQSLFPLVLPINYDTLKLLKDDDRKIALTIVEDEDEDQTKKLINLLKAAASA NRDLVFAYVGAKQWGEFADSFRDKKTTLPKMVIWDGEDDYLMVTGSESIIGNDHASEISKFIEGYREGRTEKRRVAGPAI LGFINSLIGIRTIYIIVIIVAVIMLYQNLTKEDSEYNRVDTSARDQVEQTSSSSAAEVQRSEYKAGDKED*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: cytoplasmic membrane-bounded vesicle, plasma membrane.
These properties come from phylome analysis
molecular_function: protein disulfide oxidoreductase activity, electron carrier activity, protein disulfide isomerase activity.
cellular_component: integral to membrane, plant-type cell wall, endoplasmic reticulum, vacuolar membrane.
biological_process: cell redox homeostasis, glycerol ether metabolic process.
This polypeptide in other databases
In PhylomeDB is Phy003A5HE_CUCME .

