Polypeptide MELO3C008306P1
Accession: MELO3C008306P1
Name: MELO3C008306P1
Description: Similar to Clathrin heavy chain 1 (Bos taurus) (uniprot_sprot:sp|P49951|CLH1_BOVIN)
Sequence:
>MELO3C008306P1 Similar to Clathrin heavy chain 1 (Bos taurus) (uniprot_sprot:sp|P49951|CLH1_BOVIN) MAAASAPITMKEAITLPSIGINPQFITFTHVTMESDKFICVRETAPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL ALKAQVQGSTQDHLQIFNIEQKSKMKSHLMPEQVVFWKWITPKTLGLVTQTSVYHWSTDGESEPVKVFERTANLASNQII NYRCDPSEKWLVLIGIAPGSPERPQLVKGNMQLFSVDQQRSQALEAHAAAFAQFKLPGNENPSTLISFATKTLNAGQITS KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQISHKYSLIYVITKLGLLFVYDLETAAAVYRNRISPDPIFLTA EASSVGGFYAINRRGQVLLATVNEQTIISFVSGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES PQGILRTPDTVAKFQSVPVQTGQTPPLLQYFGTLLTRGKLNAFESLELSRLVVNQNKKNLLENWLGDDKLECSEELGDLV KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQGAVNFALMMSQMEGGCPVDY NTITDLFLQRNLIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAILANGMFSHYDRPRIAQLCEKAGLYVRA LQHYTELPDIKRVIVNTHAIEPQSLVEFFGTLSREWALECMKDLLLVNLRGNLQIIVQVAKEYCEQLGVDACIKLFEQFK SYEGLYFFLGSYLSSSEDPDIHFKYIESAAKTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARPLINVCDRFGFVPD LTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLV SEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARY VVERMDGDLWEKVLNPENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQN LLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFKKFNLNVQAVNVLLDNIQSIERAVEFAFRVEEDA VWSQVAKAQLREGLVSDAIESFIRADDATQFLEVIRAAEDANVYHDLVRYLLMVREKAKEPKVDSELIYAYAKIDRLAEI EEFILMPNVANLQNVGDRLYDEALYEAAKIIFAFISNWAKLAVTLVKLKQFQGAVDAARKANSAKTWKEVCFACVDAEEF RLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRHEKLMEHIKLFSTRLNIP KLIRACDEQQHWKELTYLYIQYDEFDNAATTIMNHSPEAWDHMQFKDVAVKVANVELYYKAVHFYLQEHPDLINDLLNVL ALRVDHTRVVDIMRKAGHLLLVKPYMIAVQSNNVSAVNEALNGIYVEEEDYDRLRESIDLHDNFDQIGLAQKIEKHELLE MRRVAAYIYKKAGRWKQSIALSKKDNLYKDAMETASQSGDRELAEELLVYFIEQGKKECFASCLFVCYDLIRADVALELA WINNMVDFAFPYLLQFIREYTGKVDELVKDKIEAAKEVKAKEQEEKDVIAQQNMYAQLLPLALPAPPMPGMGGGPGMPGF APGPPQMGGLGMPPMPPFGMPPMGSSY*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein binding, structural molecule activity.
cellular_component: clathrin coat of coated pit, clathrin coat of trans-Golgi network vesicle.
biological_process: vesicle-mediated transport, intracellular protein transport.
These properties come from reactome analysis
REACTOME_REACTION: Axonal transport of NGF:Trk complexes (REACT_77014), Internalization of gap junction plaques (REACT_9971), Dab2 is recruited to the junctional plaques (REACT_9951), Transport of L1 from C-domain to P-domain (REACT_22136), trans-Golgi Network Derived Vesicle Uncoating (REACT_19124), trans-Golgi Network Coat Assembly (REACT_83374), L1 binds to AP-2 Clathrin complex (REACT_22118), Endocytosis (internalization) of clathrin-coated vesicle (REACT_30562), Phosphorylation of L1 by p90rsk (REACT_93505), trans-Golgi Network Vesicle Scission (REACT_63828), Formation of clathrin-coated vesicle (REACT_12559), Phosphorylation of L1 by ERK (REACT_22099), Phosphorylation of L1 by ERK (REACT_29300), Axonal transport of NGF:Trk complexes (REACT_12385), Phosphorylation of L1 by ERK (REACT_29029), trans-Golgi Network Coat Assembly (REACT_108535), Assembly in clathrin-coated vesicles (CCVs) (REACT_12495), Endocytosis (internalization) of clathrin-coated vesicle (REACT_12397), trans-Golgi Network Vesicle Scission (REACT_19255), L1 binds to AP-2 Clathrin complex (REACT_80391), trans-Golgi Network Lysosomal Vesicle Scission (REACT_19194), Phosphorylation of L1 by p90rsk (REACT_89089), trans-Golgi Network Vesicle Scission (REACT_91588), trans-Golgi Network Lysosomal Vesicle Scission (REACT_86358), trans-Golgi Network Derived Lysosomal Vesicle Uncoating (REACT_19206), Transport of L1 into endosomes (REACT_94455), Transport of L1 into endosomes (REACT_103820), trans-Golgi Network Lysosome Vesicle Destined Membrane Coat Assembly (REACT_19167), Phosphorylation of L1 by p90rsk (REACT_22240), Reinsertion of L1 into the plasma membrane (REACT_22298), trans-Golgi Network Coat Assembly (REACT_19334), Dynamin is recruited to the gap junction plaque (REACT_9969), Transport of L1 into endosomes (REACT_22103), Formation of clathrin coated vesicle (REACT_22359), Formation of clathrin coated vesicle (REACT_98431), Formation of clathrin coated vesicle (REACT_87661), L1 binds to AP-2 Clathrin complex (REACT_94148), Endocytosis (internalization) of clathrin-coated vesicle (REACT_92176), trans-Golgi Network Lysosome Vesicle Destined Membrane Coat Assembly (REACT_103038).
biological_process: post-Golgi vesicle-mediated transport, nerve growth factor receptor signaling pathway, epidermal growth factor receptor signaling pathway, cellular membrane organization, axon guidance, negative regulation of epidermal growth factor receptor signaling pathway.
REACTOME_COMPLEX: pL1 (S1152):p90rsk:clathrin-dynamin complex [endosome] (REACT_23209), Invaginating gap junction plaques [peroxisomal membrane] (REACT_10333), Cargo:AP-1:Beta-arrestin:Clathrin Triskelion:Vamp Complex [cytoplasmic vesicle membrane] (REACT_15080), Clathrin [plasma membrane] (REACT_9338), Planar gap junction plaques associated with Dab2 and Dynamin [plasma membrane] (REACT_10413), planar gap junction plaques associated with Dab2 [plasma membrane] (REACT_10755), L1:AP-2 Clathrin complex [endosome] (REACT_22916), Clathrin-coated vesicle [plasma membrane] (REACT_13103), Clathrin [peroxisomal membrane] (REACT_10280), EGF:Phospho-EGFR (Y1045) dimer:Phospho-CBL:GRB2:CIN85:Endophilin:Epsin:Eps15R:Eps15 complex:Clathrin [plasma membrane] (REACT_13237), L1:clathrin-coated vesicle [plasma membrane] (REACT_22698), Clathrin Triskelion [cytosol] (REACT_15049), Clathrin [plasma membrane] (REACT_11021), pL1 (S1204, 1248):ERK2:clathrin-dynamin complex [endosome] (REACT_23286), planar gap junction plaques containing Dab2 [peroxisomal membrane] (REACT_10520), Lysosome Cargo:AP-1:Beta-arrestin:Clathrin Triskelion:Vamp Complex [lysosomal membrane] (REACT_19609), Lysosome Destined Cargo:AP-1:Beta-arrestin:Vamp:Clathrin Triskelion:Dynamin:Endophilin Complex [Golgi membrane] (REACT_20224), L1:AP-2 Clathrin complex [clathrin-coated endocytic vesicle] (REACT_22867), Activated TrkA receptor complex:Clathrin-coated vesicle:dynein:dynactin complex [clathrin-coated endocytic vesicle membrane] (REACT_13375), junctional plaque prior to invagination [peroxisomal membrane] (REACT_10909), Activated TrkA receptor complex:Clathrin-coated vesicle [plasma membrane] (REACT_13141), Activated TrkA receptor complex:Clathrin-coated vesicle [clathrin-coated endocytic vesicle membrane] (REACT_13349), planar gap junction plaques [plasma membrane] (REACT_10866), Cargo:AP-1:Beta-arrestin:Vamp:Clathrin Triskelion:Dynamin:Endophilin Complex [Golgi membrane] (REACT_14893), AP2 clathrin:L1:KIF4:microtubule [cytosol] (REACT_23331).
REACTOME_PATHWAY: trans-Golgi Network Vesicle Budding (REACT_98073), Gap junction degradation (REACT_11035), Axon guidance (REACT_29862), Recycling pathway of L1 (REACT_22365), Retrograde neurotrophin signalling (REACT_12435), Lysosome Vesicle Biogenesis (REACT_19287), NGF signalling via TRKA from the plasma membrane (REACT_29880), Recycling pathway of L1 (REACT_90399), Signalling by NGF (REACT_82110), Axon guidance (REACT_110262), Signal transduction by L1 (REACT_94201), Signal transduction by L1 (REACT_89899), Golgi Associated Vesicle Biogenesis (REACT_83422), Clathrin derived vesicle budding (REACT_93134), Golgi Associated Vesicle Biogenesis (REACT_19400), L1CAM interactions (REACT_89546), EGFR downregulation (REACT_12484), Signaling by EGFR (REACT_9417), NGF signalling via TRKA from the plasma membrane (REACT_100895), Gap junction trafficking (REACT_9411), Clathrin derived vesicle budding (REACT_19187), Lysosome Vesicle Biogenesis (REACT_78428), L1CAM interactions (REACT_22205), Retrograde neurotrophin signalling (REACT_78607), Membrane Trafficking (REACT_87431), Retrograde neurotrophin signalling (REACT_109185), Clathrin derived vesicle budding (REACT_99578), Membrane Trafficking (REACT_11123), Signal transduction by L1 (REACT_22272), Gap junction trafficking and regulation (REACT_9480), trans-Golgi Network Vesicle Budding (REACT_11235), trans-Golgi Network Vesicle Budding (REACT_30453), L1CAM interactions (REACT_94606), Signalling by NGF (REACT_97378), Membrane Trafficking (REACT_34084), Recycling pathway of L1 (REACT_84142), NGF signalling via TRKA from the plasma membrane (REACT_12056), Signalling by NGF (REACT_11061), Golgi Associated Vesicle Biogenesis (REACT_99248), Formation of annular gap junctions (REACT_11049), Axon guidance (REACT_18266).
These properties come from phylome analysis
molecular_function: binding, protein binding, structural molecule activity.
cellular_component: perinuclear region of cytoplasm, apical plasma membrane, internal side of plasma membrane, synaptic vesicle, trans-Golgi network, clathrin coat of coated pit, clathrin coat of trans-Golgi network vesicle.
biological_process: compound eye retinal cell programmed cell death, positive regulation of endocytosis, regulation of tube length, open tracheal system, liquid clearance, open tracheal system, dsRNA transport, extracellular matrix organization, protein catabolic process, synaptic vesicle coating, embryo development ending in birth or egg hatching, determination of adult lifespan, sperm individualization, neurotransmitter secretion, receptor-mediated endocytosis, endocytosis, nematode larval development, reproduction, vesicle-mediated transport, intracellular protein transport.
These properties come from kegg analysis
KEGG_ORTHOLOGS: clathrin heavy chain (K04646).
This polypeptide in other databases
In PhylomeDB is Phy003A8B8_CUCME .

