Polypeptide MELO3C008344P1
Accession: MELO3C008344P1
Name: MELO3C008344P1
Description: Similar to U6 snRNA-associated Sm-like protein LSm3 (Mus musculus) (uniprot_sprot:sp|P62311|LSM3_MOUSE)
Sequence:
>MELO3C008344P1 Similar to U6 snRNA-associated Sm-like protein LSm3 (Mus musculus) (uniprot_sprot:sp|P62311|LSM3_MOUSE) MATEEESTVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEESVTTVEIDDETYEEIVRTSRRTVPFL FVRGDGVILVSPPLRTV*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: small nucleolar ribonucleoprotein complex.
These properties come from reactome analysis
REACTOME_REACTION: 5 to 3 Exoribonuclease Digestion of Decapped mRNA (REACT_96418), 5 to 3 Exoribonuclease Digestion of Decapped mRNA (REACT_87069), Decapping of mRNA by the DCP1-DCP2 Complex (REACT_20560), Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_103648), Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_20540), Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_92279), Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_107999), Decapping of mRNA by the DCP1-DCP2 Complex (REACT_98936), Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_87779), 5 to 3 Exoribonuclease Digestion of Decapped mRNA (REACT_20533), Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_100804).
biological_process: mRNA metabolic process, RNA metabolic process, nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay.
REACTOME_COMPLEX: Decapped mRNA:LSM1-7 Complex [cytosol] (REACT_21085), Deadenylated mRNA:Lsm1-7 Complex [cytosol] (REACT_20909), Lsm1-7 Complex [cytosol] (REACT_21014).
REACTOME_PATHWAY: Metabolism of RNA (REACT_92152), Metabolism of RNA (REACT_89992), Deadenylation-dependent mRNA decay (REACT_95045), Metabolism of mRNA (REACT_32511), Metabolism of mRNA (REACT_78090), Deadenylation-dependent mRNA decay (REACT_110041), Metabolism of RNA (REACT_80071), mRNA Decay by 5 to 3 Exoribonuclease (REACT_101018), Deadenylation-dependent mRNA decay (REACT_79530), mRNA Decay by 5 to 3 Exoribonuclease (REACT_110398), Deadenylation-dependent mRNA decay (REACT_89647), Metabolism of mRNA (REACT_20605), mRNA Decay by 5 to 3 Exoribonuclease (REACT_20518), Deadenylation-dependent mRNA decay (REACT_95337), Metabolism of mRNA (REACT_34551), Metabolism of mRNA (REACT_109292), mRNA Decay by 5 to 3 Exoribonuclease (REACT_29037), Metabolism of RNA (REACT_85788), mRNA Decay by 5 to 3 Exoribonuclease (REACT_84878), Metabolism of RNA (REACT_21257), Deadenylation-dependent mRNA decay (REACT_20639), mRNA Decay by 5 to 3 Exoribonuclease (REACT_88584), Metabolism of RNA (REACT_94876), Metabolism of mRNA (REACT_98319).
These properties come from phylome analysis
molecular_function: protein binding, RNA binding, nucleic acid binding.
cellular_component: catalytic step 2 spliceosome, precatalytic spliceosome, ribonucleoprotein complex, cytosol, spliceosomal complex, cytoplasmic mRNA processing body.
biological_process: exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay, cytoplasmic mRNA processing body assembly, embryo development ending in birth or egg hatching, RNA splicing, mRNA processing, nuclear mRNA splicing, via spliceosome.
These properties come from kegg analysis
KEGG_ORTHOLOGS: U6 snRNA-associated Sm-like protein LSm3 (K12622).
COG: Small nuclear ribonucleoprotein (snRNP) homolog (COG1958).
This polypeptide in other databases
In PhylomeDB is Phy003A9B1_CUCME .
