Polypeptide MELO3C008414P1

Accession: MELO3C008414P1

Name: MELO3C008414P1

Description: Similar to Putative transcription elongation factor SPT5 homolog 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9STN3|SPT51_ARATH)

Sequence:

>MELO3C008414P1 Similar to Putative transcription elongation factor SPT5 homolog 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9STN3|SPT51_ARATH)
MPRRRDDDDDIDADEEEYEDEMEQPLDDDEEEEEEDRSTRKRRRSDFIDDVAEEDEDEDEEEEDEEEEEAFGGGGRRRRA
KRPSGSQFLDIEAEVDSDDDEEDDEAEDDFIVDNVADIPDEDDNRRMHRRPLLPREDEQEDVEALERRIQARYARSNHME
YDEETTEVEQQALLPSVRDPKLWMVKCAIGREREAAVCLMQKCIDRGPEMQIRSAVALDHLKNFIYIEADKEAHVREACK
GLRNIYAQKITLVPIKEMTDVLSVESKAIDLSRDTWVRMKIGTYKGDLAKVVDVDNVRQRVTVKLIPRIDLQALANKLEG
REVAKKKAFVPPPRFMNIDEARELHIRVERRRDPITGEYFENIGGMFFKDGFLYKTVSMKSISAQNIKPTFDELEKFRKP
GENGDGDIASLSTLFANRKKGHFMKGDAVIVVKGDLKNLKGWVEKVEEENVHIRPEMKGLPKTLAVNERELCKYFEPGNH
VKVVSGTQEGATGMVVKVDQHVLIILSDTTKEHIRVFADDVVESSEVTTGVTRIGDYELHDLVLLDNMSFGVIIRVETEA
FQVLKGTPDRPEVDIVKLREIKSKIDKKISVQDRFNNTISSKDVVRILEGPCKGKQGPVEHIYRGILFIYDRHHLEHAGF
ICAKSQSCVVVGGSRTNGNRNGNSYSRFAGIATPPRFPQSPKRFSRGGPPNDSGGRHRGGRGHHDGLVGSTVKVRQGPYK
GYRGRVVEIKGQLVRVELESQMKVVTVDRNFISDNVAISTPHRDASRYGMGSETPMHPSRTPLHPYMTPMRDIGTTPIHD
GMRTPMRDRAWNPYAPMSPSRDNWEEGNPATWGASPQYQPGSPPSRTYEAPTPGSGWANTPGGSYSDAGTPRDSGSAYGG
DTEGPWYMPDILVNYRRSGDDPIMGVIREVLPDGSCRIGLGSSGNGETVTAPSSEVEVIVPRKSDKIKIMGGALRGATGK
LIGVDGTDGIVKVDDTLDVKILDLVILAKLAQP*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: transcription elongation regulator activity, structural constituent of ribosome.

cellular_component: ribosome.

biological_process: translation, positive regulation of transcription elongation from RNA polymerase II promoter.

These properties come from reactome analysis

REACTOME_PATHWAY: RNA Pol II CTD phosphorylation and interaction with CE (REACT_90040), Pausing and recovery of HIV-1 elongation (REACT_6244), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Pre-transcription Events (REACT_82727), mRNA Processing (REACT_80866), Formation and Maturation of mRNA Transcript (REACT_32779), Formation of the Early Elongation Complex (REACT_101279), Formation of the Early Elongation Complex (REACT_97522), mRNA Capping (REACT_102770), RNA Polymerase II Transcription Elongation (REACT_92836), Gene Expression (REACT_91657), RNA Polymerase II Transcription Elongation (REACT_87946), Formation of the Early Elongation Complex (REACT_99528), Transcription (REACT_93622), RNA Pol II CTD phosphorylation and interaction with CE (REACT_33716), HIV Infection (REACT_6185), mRNA Capping (REACT_93735), RNA Polymerase II Transcription Elongation (REACT_81750), RNA Polymerase II Transcription Elongation (REACT_107633), Elongation arrest and recovery (REACT_1892), RNA Polymerase II Pre-transcription Events (REACT_82104), RNA Polymerase II Transcription (REACT_97471), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), Transcription (REACT_87991), RNA Polymerase II Pre-transcription Events (REACT_22107), Transcription (REACT_34268), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription (REACT_106213), Pausing and recovery of Tat-mediated HIV-1 elongation (REACT_6143), Tat-mediated HIV-1 elongation arrest and recovery (REACT_6344), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Formation and Maturation of mRNA Transcript (REACT_96378), Gene Expression (REACT_98256), Abortive elongation of HIV-1 transcript in the absence of Tat (REACT_6261), mRNA Capping (REACT_85081), Formation of the Early Elongation Complex (REACT_846), HIV Life Cycle (REACT_6256), RNA Polymerase II Transcription Elongation (REACT_833), Elongation arrest and recovery (REACT_79615), RNA Polymerase II Transcription (REACT_1366), Elongation arrest and recovery (REACT_91132), HIV-1 elongation arrest and recovery (REACT_6259), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), Gene Expression (REACT_108313), Gene Expression (REACT_71), RNA Polymerase II Pre-transcription Events (REACT_91707), Pausing and recovery of elongation (REACT_83577), mRNA Processing (REACT_90209), Formation and Maturation of mRNA Transcript (REACT_92291), Pausing and recovery of elongation (REACT_111024), Pausing and recovery of elongation (REACT_769), Transcription (REACT_1788), Transcription (REACT_100899), mRNA Capping (REACT_1470), RNA Polymerase II Pre-transcription Events (REACT_99660), mRNA Capping (REACT_85562), Gene Expression (REACT_105649), Formation of the Early Elongation Complex (REACT_29380), mRNA Processing (REACT_1675), RNA Pol II CTD phosphorylation and interaction with CE (REACT_30624), Formation of RNA Pol II elongation complex (REACT_1845), RNA Pol II CTD phosphorylation and interaction with CE (REACT_28314), mRNA Processing (REACT_29019), RNA Polymerase II Transcription (REACT_99950), Formation and Maturation of mRNA Transcript (REACT_77979), Transcription of the HIV genome (REACT_6233), mRNA Processing (REACT_109337), RNA Pol II CTD phosphorylation and interaction with CE (REACT_6237), HIV-1 Transcription Elongation (REACT_6274), RNA Polymerase II Transcription (REACT_99228), Formation of the HIV-1 Early Elongation Complex (REACT_6319), RNA Pol II CTD phosphorylation and interaction with CE (REACT_975).

REACTOME_REACTION: Pol II elongation complex moves on the template as transcript elongates (REACT_30284), Pol II elongation complex moves on the template as transcript elongates (REACT_2053), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_77279), Abortive termination of HIV-1 elongation after arrest (Tat-containing elongation complex) (REACT_6269), Formation of the CE:GMP intermediate complex (REACT_79193), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_79829), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_95548), TFIIS-mediated recovery of HIV-1 elongation from arrest (REACT_6252), Formation of DSIF complex (REACT_109906), Separation of elongating transcript from template (REACT_81515), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6254), Formation of the CE:GMP intermediate complex (REACT_90910), Methylation of GMP-cap by RNA Methyltransferase (REACT_97945), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_102473), Separation of elongating transcript from template (REACT_2030), Capping complex formation (REACT_32400), Methylation of GMP-cap by RNA Methyltransferase (REACT_404), TFIIS-mediated recovery of elongation from arrest (REACT_1094), Separation of abortive HIV-1 transcript from template (REACT_6159), Pol II elongation complex moves on the HIV-1 template as transcript elongates (REACT_6158), Phosphorylation of NEFL by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6311), Formation of DSIF complex (REACT_77346), Dissociation of transcript with 5-GMP from GT (REACT_30543), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6155), Resumption of elongation after recovery from pausing (REACT_79713), Pol II elongation complex moves on the template as transcript elongates (REACT_30038), Formation of DSIF complex (REACT_32158), Dissociation of transcript with 5-GMP from GT (REACT_101219), Addition of nucleotides leads to transcript elongation (REACT_107064), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_97660), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_81068), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_234), TFIIS-mediated recovery of elongation from arrest (REACT_101748), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_1968), Phosphorylation of DSIF by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6316), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_1368), Formation of the CE:GMP intermediate complex (REACT_1580), Separation of elongating transcript from template (REACT_34213), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_110194), Abortive termination of elongation after arrest (REACT_95584), Capping complex formation (REACT_85029), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_423), Formation of DSIF complex (REACT_86571), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_32792), Resumption of elongation after recovery from pausing (REACT_99936), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_30549), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_2066), TFIIS-mediated recovery of elongation from arrest (REACT_6330), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_102861), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_103086), Capping complex formation (REACT_86608), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93340), Addition of nucleotides leads to transcript elongation (REACT_751), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6347), Recruitment of elongation factors to form elongation complex (REACT_949), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561), Methylation of GMP-cap by RNA Methyltransferase (REACT_34170), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6299), Formation of the CE:GMP intermediate complex (REACT_101635), Formation of DSIF:NELF:early elongation complex (REACT_96991), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_6295), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_6297), Limited elongation of the HIV-1 transcript (REACT_6192), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_78922), Dissociation of transcript with 5-GMP from GT (REACT_90647), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_85239), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6214), Dissociation of transcript with 5-GMP from GT (REACT_106203), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_29917), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6358), Formation of DSIF:NELF:HIV-1 early elongation complex (REACT_6357), Abortive termination of elongation after arrest (REACT_6355), Abortive termination of HIV-1 elongation after arrest (REACT_6352), Methylation of GMP-cap by RNA Methyltransferase (REACT_93915), Addition of nucleotides leads to transcript elongation (REACT_100466), TFIIS-mediated recovery of elongation from arrest (REACT_102520), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_6250), Capping complex formation (REACT_2186), Formation of the CE:GMP intermediate complex (REACT_92552), Elongating transcript encounters a lesion in the template (REACT_1138), Abortive termination of early transcription elongation by DSIF:NELF (REACT_86233), Abortive termination of elongation after arrest (REACT_98053), Abortive termination of early transcription elongation by DSIF:NELF (REACT_89590), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_802), Separation of elongating HIV-1 transcript from template (REACT_6204), Abortive termination of HIV-1 early transcription elongation by DSIF:NELF (REACT_6281), Abortive termination of early transcription elongation by DSIF:NELF (REACT_87802), Abortive termination of early transcription elongation by DSIF:NELF (REACT_989), Formation of DSIF:NELF:early elongation complex (REACT_981), Capping complex formation (REACT_91663), 7-14 nt. Backtracking of Pol II complex on the template leading to elongation arrest (REACT_1645), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93493), Resumption of elongation after recovery from pausing (REACT_1638), Formation of DSIF complex (REACT_1635), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_108201), Hyperphosphorylation (Ser2) of RNA Pol II CTD by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6170), Addition of nucleotides leads to HIV-1 transcript elongation (REACT_6278), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6174), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6275), Dissociation of transcript with 5-GMP from GT (REACT_703).

REACTOME_COMPLEX: HIV-1 Tat-containing paused processive elongation complex [nucleoplasm] (REACT_6389), HIV-1 Tat-containing processive elongation complex [nucleoplasm] (REACT_6452), P-TEFb(Cyclin T1:Cdk9)-containing elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_6686), DSIF complex [nucleoplasm] (REACT_2797), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6536), HIV-1 processive elongation complex [nucleoplasm] (REACT_6579), HIV-1 Tat-containing arrested processive elongation complex [nucleoplasm] (REACT_6532), Capping complex (intermediate) [nucleoplasm] (REACT_3580), Elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_5512), Capping complex (hydrolyzed) [nucleoplasm] (REACT_4969), DSIF:NELF:early elongation complex after limited nucleotide addition [nucleoplasm] (REACT_6432), HIV-1 arrested processive elongation complex [nucleoplasm] (REACT_6609), Processive elongation complex [nucleoplasm] (REACT_3018), HIV-1 Tat-containing aborted elongation complex after arrest [nucleoplasm] (REACT_6602), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_4417), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_2332), Arrested processive elongation complex [nucleoplasm] (REACT_4675), Early elongation complex with separated aborted transcript [nucleoplasm] (REACT_6590), Aborted HIV-1 early elongation complex [nucleoplasm] (REACT_6695), Aborted early elongation complex [nucleoplasm] (REACT_3362), HIV-1 aborted elongation complex after arrest [nucleoplasm] (REACT_6471), HIV-1 paused processive elongation complex [nucleoplasm] (REACT_6459), phospho-DSIF complex [nucleoplasm] (REACT_6628), HIV-1 elongation complex [nucleoplasm] (REACT_6501), Aborted elongation complex after arrest [nucleoplasm] (REACT_6654), HIV-1 early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6467), Paused processive elongation complex [nucleoplasm] (REACT_3066), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_6426), Capping complex (initial) [nucleoplasm] (REACT_4555), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD ( phospho-NELF phospho DSIF) [nucleoplasm] (REACT_6633), Tat-containing elongation complex prior to separation [nucleoplasm] (REACT_6548), HIV-1 elongation complex containing Tat [nucleoplasm] (REACT_6611), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_4575), Capping complex (GpppN..) [nucleoplasm] (REACT_2312), Elongation complex [nucleoplasm] (REACT_3511), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD and phospho-NELF [nucleoplasm] (REACT_6495), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_6594), Covalent CE:GMP intermediate complex [nucleoplasm] (REACT_2774), Early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_2481), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_6491), Capping complex (with freed 5- GMP) [nucleoplasm] (REACT_4741), Elongation complex prior to separation [nucleoplasm] (REACT_5853).

biological_process: transcription elongation from RNA polymerase II promoter, mRNA capping, positive regulation of viral transcription, viral transcription, gene expression, transcription from RNA polymerase II promoter, viral reproduction.

These properties come from phylome analysis

molecular_function: transcription elongation regulator activity, structural constituent of ribosome, RNA polymerase I transcription factor activity, translation elongation factor activity, catalytic activity, protein binding, negative transcription elongation factor activity, positive transcription elongation factor activity, RNA polymerase II transcription elongation factor activity, enzyme binding, protein heterodimerization activity.

cellular_component: ribosome, nuclear exosome (RNase complex), nucleus, nucleoplasm, polytene chromosome puff, polytene chromosome interband, mitochondrion, transcription elongation factor complex, DSIF complex.

biological_process: translation, positive regulation of transcription elongation from RNA polymerase II promoter, negative regulation of transcription from RNA polymerase II promoter, nematode larval development, DNA repair, transcription-coupled nucleotide-excision repair, chromatin organization, chromatin remodeling, transcription, DNA-dependent, regulation of transcription from RNA polymerase II promoter, transcription from RNA polymerase I promoter, transcription elongation from RNA polymerase II promoter, mRNA capping, mRNA processing, cell cycle, mitotic spindle organization, mitotic cell cycle G2/M transition DNA damage checkpoint, embryo development ending in birth or egg hatching, response to organic substance, regulation of transcription elongation, DNA-dependent, growth, hermaphrodite genitalia development, retroviral genome replication, positive regulation of transcription from RNA polymerase II promoter, positive regulation of viral transcription.

These properties come from kegg analysis

KEGG_ORTHOLOGS: transcription elongation factor SPT5 (K15172).

Locations

Located in CM3.5_scaffold00008 from 5610133 to 5619721.

This polypeptide in other databases

In PhylomeDB is Phy003MGTN_CUCME .

Related features