Polypeptide MELO3C008488P1
Accession: MELO3C008488P1
Name: MELO3C008488P1
Description: Similar to Splicing factor 3A subunit 3 (Homo sapiens) (uniprot_sprot:sp|Q12874|SF3A3_HUMAN)
Sequence:
>MELO3C008488P1 Similar to Splicing factor 3A subunit 3 (Homo sapiens) (uniprot_sprot:sp|Q12874|SF3A3_HUMAN) MSSTLLEVTRSSHEEVERLERLIVKELQNEPASGKDRLLQSHRVRNMIDTIMSTTEKLIEIYEDKDSARKDEIAALGGQT TSGTNVFSAFYDRLKEIREYHRRHPAARVVDVSEDDGLLKEEPQIEFSGEEAFGRYLDLHELYNQYINSKFGEAIEYSSY LDIFSQPQKISQKLKFSRQYREYLENLLAYLIYFFQRTEPLQDLDRIFSKVESEFEERWAIGTIEGWENTSQDNGHDSAQ HSLIDLDYYSSVEELVELGPERLKEGLAALGLKTGGTVQQRAERLFLTKHTPLQLLDKKHFAKLSRQPIQNWMAVASQNN ENLKQVALMEAKIEKLCDLLDETIARTKDNIVKKQALTYEEIEAEREEEETQAESESDDEEQQIYNPLKLPMGWDGKPIP YWLYKLHGLGQEFKCEICGNYSYWGRRAFERHFKEWRHQHGMRCLGIPNTKNFNEITSIEEAKDLWKRIQERQGVNKWRP DLEEEYEDKEGNIYNKKTYTDLQRQGLI*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: zinc ion binding, nucleic acid binding.
cellular_component: nucleus.
These properties come from reactome analysis
REACTOME_REACTION: Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Formation of the Spliceosomal B Complex (REACT_90182), Formation of the Spliceosomal A Complex (REACT_788), Formation of an intermediate Spliceosomal C complex (REACT_91565), Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of the active Spliceosomal C complex (REACT_1554), Formation of the active Spliceosomal C complex (REACT_89446), Formation of the active Spliceosomal C complex (REACT_63591), Formation of Exon Junction Complex (REACT_85923), Formation of Exon Junction Complex (REACT_92827), Formation of the Spliceosomal B Complex (REACT_48), Formation of Exon Junction Complex (REACT_774), Formation of an intermediate Spliceosomal C complex (REACT_108009), Formation of the Spliceosomal B Complex (REACT_109266), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331).
REACTOME_PATHWAY: Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), Gene Expression (REACT_108313), mRNA Splicing - Major Pathway (REACT_467), mRNA Splicing (REACT_107931), Formation and Maturation of mRNA Transcript (REACT_2039), mRNA Splicing - Major Pathway (REACT_93740), Gene Expression (REACT_105649), Gene Expression (REACT_71), mRNA Processing (REACT_29019), mRNA Splicing (REACT_94469), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), mRNA Splicing - Major Pathway (REACT_91611), Formation and Maturation of mRNA Transcript (REACT_32779), Formation and Maturation of mRNA Transcript (REACT_77979), mRNA Processing (REACT_80866), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), mRNA Processing (REACT_1675), mRNA Splicing (REACT_1735).
REACTOME_COMPLEX: Spliceosomal A Complex [nucleoplasm] (REACT_4512), Exon Junction Complex [nucleoplasm] (REACT_2984), U2 snRNP [nucleoplasm] (REACT_3715), SF3A [nucleoplasm] (REACT_5131), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), intron-containing complex [nucleoplasm] (REACT_3239).
biological_process: RNA splicing, gene expression, nuclear mRNA splicing, via spliceosome.
These properties come from phylome analysis
molecular_function: protein binding, zinc ion binding, nucleic acid binding.
cellular_component: catalytic step 2 spliceosome, precatalytic spliceosome, nuclear speck, cytosol, spliceosomal complex, nucleus.
biological_process: positive regulation of NFAT protein import into nucleus, regulation of embryo sac egg cell differentiation, regulation of cell proliferation, inductive cell migration, hermaphrodite genitalia development, regulation of meiosis, molting cycle, collagen and cuticulin-based cuticle, body morphogenesis, embryo development ending in birth or egg hatching, fertilization, gonad development, germ cell development, mitosis, mitotic spindle organization, nuclear mRNA splicing, via spliceosome, nuclear mRNA 3'-splice site recognition.
These properties come from kegg analysis
KEGG_ORTHOLOGS: splicing factor 3A subunit 3 (K12827).
This polypeptide in other databases
In PhylomeDB is Phy003A2F9_CUCME .
