Polypeptide MELO3C008589P1

Accession: MELO3C008589P1

Name: MELO3C008589P1

Description: Similar to DNA-directed RNA polymerase II subunit RPB3-A (Arabidopsis thaliana) (uniprot_sprot:sp|Q39211|RPB3A_ARATH)

Sequence:

>MELO3C008589P1 Similar to DNA-directed RNA polymerase II subunit RPB3-A (Arabidopsis thaliana) (uniprot_sprot:sp|Q39211|RPB3A_ARATH)
MEGSSYQRFPKVKIRELRDDYAKFELRDTDASMANALRRVMIAEVPTIAIDLVEIEVNSSVLNDEFIAHRLGLIPLTSER
AMSMRFSRDCDACDGDGQCEFCSVEFHLRAKCHSDQTLDVTSKDLYSSDHTVVPVDFSDSAAATGEALDTKGIIIVKLRR
GQELRLRAIARKGIGKDHAKWSPAATVTFMYEPSIHINEDLMETLTLEEKKNLG*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: DNA binding, DNA-directed RNA polymerase activity, protein dimerization activity.

biological_process: transcription, DNA-dependent.

These properties come from reactome analysis

REACTOME_PATHWAY: RNA Polymerase II Transcription (REACT_99228), Dual incision reaction in TC-NER (REACT_109190), mRNA Splicing (REACT_94469), Formation of the Early Elongation Complex (REACT_101279), mRNA Capping (REACT_102770), mRNA Splicing - Major Pathway (REACT_91611), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), DNA Repair (REACT_82907), RNA Pol II CTD phosphorylation and interaction with CE (REACT_96584), Elongation arrest and recovery (REACT_1892), Nucleotide Excision Repair (REACT_96106), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_1941), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_78187), Pausing and recovery of Tat-mediated HIV-1 elongation (REACT_6143), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34355), RNA Polymerase II Transcription Elongation (REACT_87946), RNA Pol II CTD phosphorylation and interaction with CE (REACT_90040), Abortive elongation of HIV-1 transcript in the absence of Tat (REACT_6261), mRNA Capping (REACT_85081), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), Formation of the Early Elongation Complex (REACT_846), HIV Life Cycle (REACT_6256), HIV-1 elongation arrest and recovery (REACT_6259), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), Transcription-coupled NER (TC-NER) (REACT_29182), Transcription (REACT_87991), Transcription (REACT_1788), Gene Expression (REACT_85241), mRNA Capping (REACT_1470), mRNA Capping (REACT_81603), RNA Pol II CTD phosphorylation and interaction with CE (REACT_30624), Transcription-coupled NER (TC-NER) (REACT_87141), mRNA Splicing - Minor Pathway (REACT_101749), RNA Polymerase II Pre-transcription Events (REACT_82727), RNA Polymerase II Transcription Elongation (REACT_92836), Formation of the HIV-1 Early Elongation Complex (REACT_6319), Pausing and recovery of HIV-1 elongation (REACT_6244), RNA Polymerase II Promoter Escape (REACT_81662), Gene Expression (REACT_91657), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_109232), mRNA Splicing - Major Pathway (REACT_93740), mRNA Splicing (REACT_107931), DNA Repair (REACT_88201), Transcription (REACT_93622), RNA Pol II CTD phosphorylation and interaction with CE (REACT_33716), mRNA Capping (REACT_93735), RNA Polymerase II Transcription Elongation (REACT_81750), RNA Polymerase II Promoter Escape (REACT_107789), RNA Polymerase II Transcription (REACT_97471), Processing of Capped Intron-Containing Pre-mRNA (REACT_109442), mRNA Processing (REACT_109337), RNA Polymerase II Transcription (REACT_1366), Elongation arrest and recovery (REACT_91132), RNA Polymerase II Transcription Initiation (REACT_104646), RNA Polymerase II Pre-transcription Events (REACT_91707), Formation and Maturation of mRNA Transcript (REACT_77979), Formation and Maturation of mRNA Transcript (REACT_92291), RNA Polymerase II Transcription Elongation (REACT_94090), mRNA Splicing (REACT_81581), DNA Repair (REACT_91442), mRNA Processing (REACT_1675), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_85257), Formation of RNA Pol II elongation complex (REACT_1845), mRNA Splicing (REACT_98879), Transcription of the HIV genome (REACT_6233), mRNA Capping (REACT_85562), RNA Pol II CTD phosphorylation and interaction with CE (REACT_6237), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_87559), HIV-1 Transcription Initiation (REACT_6332), RNA Pol II CTD phosphorylation and interaction with CE (REACT_975), RNA Polymerase II Promoter Escape (REACT_106149), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_86892), mRNA Processing (REACT_80866), Formation and Maturation of mRNA Transcript (REACT_32779), Formation of the Early Elongation Complex (REACT_97522), DNA Repair (REACT_216), RNA Polymerase II Promoter Escape (REACT_2089), mRNA Splicing - Minor Pathway (REACT_1753), HIV Infection (REACT_6185), RNA Polymerase II Transcription Initiation (REACT_1851), Gene Expression (REACT_108313), RNA Polymerase II Pre-transcription Events (REACT_22107), Transcription (REACT_34268), Transcription-coupled NER (TC-NER) (REACT_29721), Tat-mediated HIV-1 elongation arrest and recovery (REACT_6344), Nucleotide Excision Repair (REACT_106982), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Gene Expression (REACT_98256), mRNA Splicing - Minor Pathway (REACT_88186), RNA Polymerase II Transcription Elongation (REACT_107633), Elongation arrest and recovery (REACT_79615), mRNA Splicing (REACT_1735), RNA Polymerase II Transcription Initiation (REACT_105389), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_102536), Gene Expression (REACT_71), Pausing and recovery of elongation (REACT_83577), Dual incision reaction in TC-NER (REACT_81556), RNA Polymerase II Promoter Escape (REACT_32829), mRNA Splicing - Minor Pathway (REACT_101135), Transcription (REACT_100899), Dual incision reaction in TC-NER (REACT_94657), RNA Polymerase II Pre-transcription Events (REACT_99660), Pausing and recovery of elongation (REACT_769), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), Processing of Capped Intron-Containing Pre-mRNA (REACT_30593), RNA Pol II CTD phosphorylation and interaction with CE (REACT_28314), mRNA Processing (REACT_29019), RNA Polymerase II Transcription (REACT_99950), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_28862), Nucleotide Excision Repair (REACT_88933), Nucleotide Excision Repair (REACT_1826), Nucleotide Excision Repair (REACT_84438), Nucleotide Excision Repair (REACT_77033), DNA Repair (REACT_107446), RNA Polymerase II Transcription Initiation (REACT_104036), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription Initiation (REACT_88340), Dual incision reaction in TC-NER (REACT_91002), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_79444), Gene Expression (REACT_105649), RNA Polymerase II Transcription (REACT_89454), Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), DNA Repair (REACT_93704), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_91566), Formation of the Early Elongation Complex (REACT_99528), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34737), Dual incision reaction in TC-NER (REACT_2222), Transcription-coupled NER (TC-NER) (REACT_1628), Transcription (REACT_99758), RNA Polymerase II Pre-transcription Events (REACT_82104), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), RNA Polymerase II Pre-transcription Events (REACT_91410), RNA Polymerase II Transcription Initiation (REACT_87429), Formation of the Early Elongation Complex (REACT_29380), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription (REACT_106213), RNA Polymerase II Promoter Escape (REACT_109274), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_98915), RNA Polymerase II Transcription Elongation (REACT_833), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_88014), Dual incision reaction in TC-NER (REACT_30923), HIV-1 Transcription Elongation (REACT_6274), mRNA Processing (REACT_90209), mRNA Splicing - Major Pathway (REACT_467), Transcription-coupled NER (TC-NER) (REACT_93719), Pausing and recovery of elongation (REACT_111024), Formation and Maturation of mRNA Transcript (REACT_96378), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_83749), Formation and Maturation of mRNA Transcript (REACT_85219), mRNA Splicing - Minor Pathway (REACT_91088), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_83742), Formation of the Early Elongation Complex (REACT_84349), Transcription-coupled NER (TC-NER) (REACT_96116), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), mRNA Processing (REACT_94551), Processing of Capped Intron-Containing Pre-mRNA (REACT_31128).

REACTOME_REACTION: RNA Polymerase II Promoter Opening: First Transition (REACT_29850), RNA Polymerase II Promoter Opening: First Transition (REACT_93391), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_105022), Pol II elongation complex moves on the template as transcript elongates (REACT_30284), Formation of AT-AC B Complex (REACT_1253), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_1251), Formation of the Spliceosomal B Complex (REACT_48), RNA Polymerase II Promoter Opening: First Transition (REACT_80107), Abortive Initiation After Second Transition (REACT_1793), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_84917), Abortive initiation after formation of the first phosphodiester bond (REACT_32630), Internal Methylation of mRNA (REACT_30916), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_77961), Formation of the closed pre-initiation complex (REACT_82855), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Phosphorylation (Ser5) of RNA pol II CTD (REACT_88766), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Formation of active Pol II complex with lesioned DNA template (REACT_89270), Internal Methylation of mRNA (REACT_1720), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_1082), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_102473), Pol II elongation complex moves on the template as transcript elongates (REACT_2053), Abortive initiation after formation of the first phosphodiester bond (REACT_653), Fall Back to Closed Pre-initiation Complex (REACT_6211), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_1494), Abortive termination of HIV-1 elongation after arrest (Tat-containing elongation complex) (REACT_6269), Resumption of transcription after TC-NER (REACT_551), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_88434), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_79829), Abortive HIV-1 Initiation After Second Transition (REACT_6265), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_2233), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_95548), Extrusion of 5-end of 30 nt long HIV-1 transcript through the pore in Pol II complex (REACT_6148), TFIIS-mediated recovery of HIV-1 elongation from arrest (REACT_6252), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_6250), Formation of the closed pre-initiation complex (REACT_91116), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6254), RNA Polymerase II Promoter Opening: First Transition (REACT_94679), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_85925), Formation of the CE:GMP intermediate complex (REACT_90910), Methylation of GMP-cap by RNA Methyltransferase (REACT_97945), Dissociation of transcript with 5-GMP from GT (REACT_87469), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_82574), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_99814), Phosphorylation (Ser5) of RNA pol II CTD (REACT_90675), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_94470), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_802), NTP Binds Active Site of RNA Polymerase II (REACT_84849), Methylation of GMP-cap by RNA Methyltransferase (REACT_404), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_29457), Formation of active Pol II complex with lesioned DNA template (REACT_96240), Formation of active Pol II complex with lesioned DNA template (REACT_28257), Formation of active Pol II complex with lesioned DNA template (REACT_105740), TFIIS-mediated recovery of elongation from arrest (REACT_1094), Formation of AT-AC C complex (REACT_83124), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_1968), Separation of abortive HIV-1 transcript from template (REACT_6159), Pol II elongation complex moves on the HIV-1 template as transcript elongates (REACT_6158), Phosphorylation of NEFL by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6311), Capping complex formation (REACT_32400), Phosphorylation of DSIF by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6316), Dissociation of transcript with 5-GMP from GT (REACT_30543), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_95240), Binding of TFIIE to the growing preinitiation complex (REACT_82447), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6155), Resumption of elongation after recovery from pausing (REACT_79713), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_103685), Formation of the closed pre-initiation complex (REACT_83351), Pol II elongation complex moves on the template as transcript elongates (REACT_30038), Addition of nucleotides between position +11 and +30 on HIV-1 transcript (REACT_6240), Dissociation of transcript with 5-GMP from GT (REACT_101219), Methylation of GMP-cap by RNA Methyltransferase (REACT_96650), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_88546), Addition of nucleotides leads to transcript elongation (REACT_107064), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_97660), Resumption of elongation after recovery from pausing (REACT_99936), Resumption of transcription after TC-NER (REACT_29828), NTP Binds Active Site of RNA Polymerase II (REACT_86985), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_81068), Resumption of transcription after TC-NER (REACT_101665), Internal Methylation of mRNA (REACT_28726), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_1567), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_234), Displacement of stalled Pol II from the lesion site (REACT_82387), Formation of Exon Junction Complex (REACT_92827), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86649), Activation of GT (REACT_96305), Formation of Exon Junction Complex (REACT_85923), Formation of pre-mRNPs (REACT_1877), Fall Back to Closed Pre-initiation Complex (REACT_1702), Addition of nucleotides between position +11 and +30 (REACT_77879), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_78922), Dissociation of transcript with 5-GMP from GT (REACT_106203), Fall Back to Closed Pre-initiation Complex (REACT_92728), TFIIS-mediated recovery of elongation from arrest (REACT_101748), Formation of the closed pre-initiation complex (REACT_632), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_100344), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_81825), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_1368), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_33423), Formation of the CE:GMP intermediate complex (REACT_1580), Dissociation of transcript with 5-GMP from GT (REACT_90647), NTP Binds Active Site of RNA Polymerase II (REACT_80520), Addition of nucleotides between position +11 and +30 (REACT_29713), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28433), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_110194), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Formation of AT-AC C complex (REACT_110048), Capping complex formation (REACT_85029), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_108808), Formation of the Spliceosomal E complex (REACT_222), Formation of AT-AC C complex (REACT_78819), Displacement of stalled Pol II from the lesion site (REACT_1284), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_423), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_81731), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28192), Formation of active Pol II complex with lesioned DNA template (REACT_97303), Fall Back to Closed Pre-initiation Complex (REACT_86577), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_32792), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Formation of DSIF:NELF:early elongation complex (REACT_96991), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_101583), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_77594), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_30549), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_1947), Abortive Initiation After Second Transition (REACT_108713), Phosphorylation (Ser5) of RNA pol II CTD (REACT_6234), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_2066), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93493), TFIIS-mediated recovery of elongation from arrest (REACT_6330), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), HIV-1 Promoter Opening: First Transition (REACT_6134), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_102861), Abortive termination of elongation after arrest (REACT_95584), Phosphorylation (Ser5) of RNA pol II CTD (REACT_31984), RNA Polymerase II Promoter Opening: First Transition (REACT_89694), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_86293), Formation of the closed pre-initiation complex (REACT_105039), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_81891), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_103086), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_88439), Activation of GT (REACT_893), Internal Methylation of mRNA (REACT_85125), Formation of AT-AC B Complex (REACT_93825), Capping complex formation (REACT_86608), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_2241), Formation of AT-AC B Complex (REACT_100957), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_103482), Displacement of stalled Pol II from the lesion site (REACT_103124), Displacement of stalled Pol II from the lesion site (REACT_87615), NTP Binds Active Site of RNA Polymerase II (REACT_106132), Addition of nucleotides between position +11 and +30 (REACT_28303), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93340), Formation of active Pol II complex with lesioned DNA template (REACT_1453), Resumption of transcription after TC-NER (REACT_94622), Fall Back to Closed Pre-initiation Complex (REACT_31744), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_83079), NTP Binds Active Site of RNA Polymerase II (REACT_1160), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_109877), Addition of nucleotides leads to transcript elongation (REACT_751), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_6220), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Formation of the CE:GMP intermediate complex (REACT_110689), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_34550), Addition of nucleotides between position +11 and +30 (REACT_28970), Formation of AT-AC A complex (REACT_864), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6347), Recruitment of elongation factors to form elongation complex (REACT_949), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_87062), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_93916), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_77279), Resumption of transcription after TC-NER (REACT_80496), Methylation of GMP-cap by RNA Methyltransferase (REACT_34170), Activation of GT (REACT_6298), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6299), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_81096), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_6297), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_105023), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_6295), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_99299), Activation of GT (REACT_103913), Activation of GT (REACT_103525), Phosphorylation (Ser5) of RNA pol II CTD (REACT_77857), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_79518), Recognition and binding of the mRNA cap by the cap-binding complex (REACT_687), Addition of nucleotides between position +11 and +30 (REACT_209), Activation of GT (REACT_84234), Resumption of transcription after TC-NER (REACT_88101), Limited elongation of the HIV-1 transcript (REACT_6192), Abortive termination of HIV-1 early transcription elongation by DSIF:NELF (REACT_6281), Formation of AT-AC C complex (REACT_1615), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Abortive termination of early transcription elongation by DSIF:NELF (REACT_89590), Binding of TFIIE to the growing preinitiation complex (REACT_78942), Binding of TFIIE to the growing preinitiation complex (REACT_32367), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_104426), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_90318), Capping complex formation (REACT_77633), Formation of AT-AC B Complex (REACT_101559), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_85239), Formation of the Spliceosomal B Complex (REACT_90182), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6214), Assembly of repair proteins at the site of Pol II blockage (REACT_1584), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_86848), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_29917), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6358), Formation of DSIF:NELF:HIV-1 early elongation complex (REACT_6357), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_29379), Abortive termination of elongation after arrest (REACT_6355), Abortive termination of HIV-1 elongation after arrest (REACT_6352), Abortive Initiation After Second Transition (REACT_103184), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331), Abortive Initiation After Second Transition (REACT_103180), Methylation of GMP-cap by RNA Methyltransferase (REACT_93915), Addition of nucleotides leads to transcript elongation (REACT_100466), TFIIS-mediated recovery of elongation from arrest (REACT_102520), Separation of elongating transcript from template (REACT_81515), Capping complex formation (REACT_2186), NTP Binds Active Site of RNA Polymerase II (REACT_80120), Formation of the active Spliceosomal C complex (REACT_63591), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Formation of the CE:GMP intermediate complex (REACT_92552), Elongating transcript encounters a lesion in the template (REACT_1138), Formation of the CE:GMP intermediate complex (REACT_79193), Formation of an intermediate Spliceosomal C complex (REACT_91565), Abortive termination of early transcription elongation by DSIF:NELF (REACT_86233), Abortive termination of early transcription elongation by DSIF:NELF (REACT_87802), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_96127), Formation of AT-AC B Complex (REACT_90655), Phosphorylation (Ser5) of RNA pol II CTD (REACT_1185), Formation of an intermediate Spliceosomal C complex (REACT_108009), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_34583), Formation of the active Spliceosomal C complex (REACT_89446), Abortive termination of elongation after arrest (REACT_98053), Displacement of stalled Pol II from the lesion site (REACT_28718), Formation of Exon Junction Complex (REACT_774), Displacement of stalled Pol II from the lesion site (REACT_108076), Addition of nucleotides 10 and 11 on the growing HIV-1 transcript: Third Transition (REACT_6208), Abortive Initiation Before Second Transition (REACT_106763), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_92765), Recognition and binding of the HIV-1 mRNA cap by the cap-binding complex (REACT_6166), Phosphorylation (Ser5) of RNA pol II CTD (REACT_91157), Internal Methylation of mRNA (REACT_101890), Formation of the closed pre-initiation complex (REACT_98407), Separation of elongating transcript from template (REACT_2030), Separation of elongating HIV-1 transcript from template (REACT_6204), Fall Back to Closed Pre-initiation Complex (REACT_100253), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_6206), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_110236), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86674), Fall Back to Closed Pre-initiation Complex (REACT_98220), Formation of the Spliceosomal B Complex (REACT_109266), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_30335), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_34608), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_103987), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_100578), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_33504), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_88577), Abortive termination of early transcription elongation by DSIF:NELF (REACT_989), Activation of GT (REACT_106797), Formation of the active Spliceosomal C complex (REACT_1554), Formation of AT-AC C complex (REACT_95722), Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of DSIF:NELF:early elongation complex (REACT_981), Capping complex formation (REACT_91663), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_29681), 7-14 nt. Backtracking of Pol II complex on the template leading to elongation arrest (REACT_1645), Formation of the CE:GMP intermediate complex (REACT_101635), Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Resumption of elongation after recovery from pausing (REACT_1638), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_108201), Separation of elongating transcript from template (REACT_34213), Formation of the Spliceosomal A Complex (REACT_788), Addition of nucleotides between position +11 and +30 (REACT_90076), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Hyperphosphorylation (Ser2) of RNA Pol II CTD by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6170), Addition of nucleotides leads to HIV-1 transcript elongation (REACT_6278), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6174), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6275), Abortive Initiation Before Second Transition (REACT_543), Dissociation of transcript with 5-GMP from GT (REACT_703).

REACTOME_COMPLEX: HIV-1 Tat-containing paused processive elongation complex [nucleoplasm] (REACT_6389), RNA Polymerase II (unphosphorylated):TFIIF complex [nucleoplasm] (REACT_2692), Capping complex (intermediate) [nucleoplasm] (REACT_3580), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), Capping complex (hydrolyzed) [nucleoplasm] (REACT_4969), HIV-1 transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_6664), Pol II transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_2595), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_3171), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), RNA Polymerase II holoenzyme complex (hyperphosphorylated) [nucleoplasm] (REACT_4889), Stalled Pol II complex with damaged DNA hybrid [nucleoplasm] (REACT_3072), Arrested processive elongation complex [nucleoplasm] (REACT_4675), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_6382), pol II transcription complex containing 11 nucleotide long transcript [nucleoplasm] (REACT_3183), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_6521), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), RNA Pol II with phosphorylated CTD: CE complex with activated GT [nucleoplasm] (REACT_6659), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Aborted elongation complex after arrest [nucleoplasm] (REACT_6654), RNA Polymerase II holoenzyme complex (unphosphorylated) [nucleoplasm] (REACT_4217), RNA Pol II with phosphorylated CTD: CE complex [nucleoplasm] (REACT_2371), Spliceosomal A Complex [nucleoplasm] (REACT_4512), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD and phospho-NELF [nucleoplasm] (REACT_6495), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_6491), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Capping complex (with freed 5- GMP) [nucleoplasm] (REACT_4741), Elongation complex prior to separation [nucleoplasm] (REACT_5853), HIV-1 Tat-containing arrested processive elongation complex [nucleoplasm] (REACT_6532), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6536), Elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_5512), DSIF:NELF:early elongation complex after limited nucleotide addition [nucleoplasm] (REACT_6432), HIV-1 transcription complex [nucleoplasm] (REACT_6433), pol II transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_5212), Processive elongation complex [nucleoplasm] (REACT_3018), Stalled Pol II in TC-NER [nucleoplasm] (REACT_4443), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), Aborted early elongation complex [nucleoplasm] (REACT_3362), RNA polymerase II (phosphorylated):TFIIF complex [nucleoplasm] (REACT_4593), capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_3243), HIV-1 Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_6503), HIV-1 elongation complex [nucleoplasm] (REACT_6501), RNA Polymerase II holoenzyme complex (generic) [nucleoplasm] (REACT_12944), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_6426), ATAC C Complex with lariat containing 5-end cleaved mRNA [nucleoplasm] (REACT_5134), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD ( phospho-NELF phospho DSIF) [nucleoplasm] (REACT_6633), HIV-1 transcription complex with (ser5) phosphorylated CTD containing extruded transcript to +30 [nucleoplasm] (REACT_6638), Capping complex (GpppN..) [nucleoplasm] (REACT_2312), Active Pol II complex with repaired DNA template:mRNA hybrid [nucleoplasm] (REACT_2462), Covalent CE:GMP intermediate complex [nucleoplasm] (REACT_2774), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 Tat-containing processive elongation complex [nucleoplasm] (REACT_6452), HIV-1 paused processive elongation complex [nucleoplasm] (REACT_6459), HIV-1 transcription complex containing transcript to +30 [nucleoplasm] (REACT_6514), HIV-1 transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_6516), pol II transcription complex [nucleoplasm] (REACT_2954), Spliceosomal E Complex [nucleoplasm] (REACT_4545), Tat-containing elongation complex prior to separation [nucleoplasm] (REACT_6548), ATAC A Complex [nucleoplasm] (REACT_4037), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_3928), Aborted HIV-1 early elongation complex [nucleoplasm] (REACT_6695), HIV-1 transcription complex containing 9 nucleotide long transcript [nucleoplasm] (REACT_6561), HIV-1 transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_6563), Capping complex (initial) [nucleoplasm] (REACT_4555), HIV-1 elongation complex containing Tat [nucleoplasm] (REACT_6611), Pol II initiation complex [nucleoplasm] (REACT_5487), Early elongation complex with separated aborted transcript [nucleoplasm] (REACT_6590), Pol II transcription complex containing extruded transcript to +30 [nucleoplasm] (REACT_4335), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_6594), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), Early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_2481), RNA Polymerase II holoenzyme complex (phosphorylated) [nucleoplasm] (REACT_5819), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), ATAC C Complex [nucleoplasm] (REACT_4626), P-TEFb(Cyclin T1:Cdk9)-containing elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_6686), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 processive elongation complex [nucleoplasm] (REACT_6579), HIV-1 aborted elongation complex after arrest [nucleoplasm] (REACT_6471), post exon ligation complex [nucleoplasm] (REACT_5793), RNA Polymerase II (phosphorylated):TFIIF:capped pre-mRNA [nucleoplasm] (REACT_3935), HIV-1 arrested processive elongation complex [nucleoplasm] (REACT_6609), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), Pol II transcription complex containing transcript to +30 [nucleoplasm] (REACT_4399), HIV-1 Tat-containing aborted elongation complex after arrest [nucleoplasm] (REACT_6602), capped, methylated pre-mRNA:CBC Complex [nucleoplasm] (REACT_3634), ATAC B Complex [nucleoplasm] (REACT_5095), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_4417), CE:Pol II CTD:Spt5 complex [nucleoplasm] (REACT_2332), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), RNA Polymearse II:NTP:TFIIF complex [nucleoplasm] (REACT_4655), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_5658), HIV-1 capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_6374), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), RNA Polymerase II holoenzyme complex (hyperphosphorylated):TFIIF complex [nucleoplasm] (REACT_3841), HIV-1 early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6467), Paused processive elongation complex [nucleoplasm] (REACT_3066), Exon Junction Complex [nucleoplasm] (REACT_2984), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_4575), Elongation complex [nucleoplasm] (REACT_3511), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), Active Pol II transcription complex with damaged DNA hybrid [nucleoplasm] (REACT_3609), capped, methylated pre-mRNP:CBC complex [nucleoplasm] (REACT_2736), RNA Polymerase II holoenzyme complex (hypophosphorylated):TFIIF complex [nucleoplasm] (REACT_5870).

biological_process: nuclear mRNA splicing, via spliceosome, transcription-coupled nucleotide-excision repair, transcription initiation from RNA polymerase II promoter, transcription elongation from RNA polymerase II promoter, mRNA capping, RNA splicing, viral reproduction, positive regulation of viral transcription, DNA repair, nucleotide-excision repair, viral transcription, transcription from RNA polymerase II promoter, gene expression.

These properties come from phylome analysis

molecular_function: DNA binding, DNA-directed RNA polymerase activity, protein dimerization activity, metal ion binding.

cellular_component: nucleus, DNA-directed RNA polymerase II, core complex, polytene chromosome puff, cytoplasm, microtubule associated complex.

biological_process: transcription, DNA-dependent, reproduction, nuclear mRNA splicing, via spliceosome, gastrulation with mouth forming first, nematode larval development, transcription-coupled nucleotide-excision repair, transcription initiation from RNA polymerase II promoter, transcription elongation from RNA polymerase II promoter, termination of RNA polymerase II transcription, mRNA capping, RNA splicing, embryo development ending in birth or egg hatching, viral reproduction, cellular response to heat, growth, positive regulation of growth rate, locomotion, positive regulation of viral transcription.

These properties come from kegg analysis

KEGG_REACTION: ATP:polynucleotide (R00435), GTP:RNA (R00441), CTP:RNA (R00442), UTP:RNA (R00443).

KEGG_ORTHOLOGS: DNA-directed RNA polymerase II subunit RPB3 (K03011).

molecular_function: DNA-directed RNA polymerase activity.

COG: DNA-directed RNA polymerase, alpha subunit/40 kD subunit (COG0202).

Locations

Located in CM3.5_scaffold00009 from 2754423 to 2755394.

This polypeptide in other databases

In PhylomeDB is Phy003A29V_CUCME .

Related features