Polypeptide MELO3C008709P1

Accession: MELO3C008709P1

Name: MELO3C008709P1

Description: Similar to Probable sodium-coupled neutral amino acid transporter 6 (Xenopus tropicalis) (uniprot_sprot:sp|Q28HE5|S38A6_XENTR)

Sequence:

>MELO3C008709P1 Similar to Probable sodium-coupled neutral amino acid transporter 6 (Xenopus tropicalis) (uniprot_sprot:sp|Q28HE5|S38A6_XENTR)
MTIENFTPREEKRSDRKKSAVDEKSPLLPSRQDDGSGVNEFSGASFSGAVFNLSTTIIGAGIMALPAMVKELGLLLGVAM
IIIMAFLTEASIELLLRFSRPRKSTSYGGLMGDAFGRYGKIMLQICVLVNNIGVLTVYMIIIGDVLSGTTASGVHHAGVL
EGWFGQQWWNGRFFVLLFTTLGIFAPLACFKRIDSLSYTSALSVALAVVFLVITIGISVYKLIDGSINMPRLLPEIIDIS
SFLKLFTAVPVVVTAYVCHYNVHSISNELEDSSQIKAVVRTAIALCASVYIMTSIFGYLLFGEGTLSDVLANFDADLGIP
YGSVFNDAVRVSYAAHLMLVFPIVFYPLRVNLDGLLFPSARPLLRDNLRFSLITVTLITLLFLGANFIPSIWDVFQFTGA
TAAVCLGFIFPASVALRDSHNIATKKDKVLGIFMVVLAVFSNIIAIYSDAYALFKRDSSPRN*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Glutamine transport from astrocytes (REACT_33865), SLC38A1 (ATA1)-mediated uptake of neutral amino acids (REACT_29874), Glutamine transport from astrocytes (REACT_78488), SLC38A1 (ATA1)-mediated uptake of neutral amino acids (REACT_84982), SLC38A4 (ATA3)-mediated uptake of arginine and lysine (REACT_29069), L-Glutamine transport into neurons (REACT_32701), SLC38A5-mediated uptake of glutamine, histidine, asparagine, and serine (REACT_106600), SLC38A5-mediated uptake of glutamine, histidine, asparagine, and serine (REACT_96958), SLC38A2 (ATA2)-mediated uptake of neutral amino acids (REACT_30139), SLC38A4 (ATA3)-mediated uptake of arginine and lysine (REACT_30036), L-Glutamine transport into neurons (REACT_102837), SLC38A2 (ATA2)-mediated uptake of neutral amino acids (REACT_96961).

biological_process: transmembrane transport, synaptic transmission, neurotransmitter secretion, glutamate secretion, ion transport, neurotransmitter uptake, cellular nitrogen compound metabolic process, amino acid transport.

REACTOME_PATHWAY: Metabolism of amino acids and derivatives (REACT_90299), Metabolism of amino acids and derivatives (REACT_107293), SLC-mediated transmembrane transport (REACT_87124), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_29110), Transmembrane transport of small molecules (REACT_81024), Synaptic Transmission (REACT_99952), Amino acid transport across the plasma membrane (REACT_107151), Synaptic Transmission (REACT_82746), Transmission across Chemical Synapses (REACT_99535), Neurotransmitter uptake and Metabolism In Glial Cells (REACT_98224), Transmission across Chemical Synapses (REACT_79078), Neurotransmitter uptake and Metabolism In Glial Cells (REACT_107830), Amino acid and oligopeptide SLC transporters (REACT_99981), Glutamate Neurotransmitter Release Cycle (REACT_79842), Amino acid and oligopeptide SLC transporters (REACT_94050), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_110862), Transmembrane transport of small molecules (REACT_97365), Astrocytic Glutamate-Glutamine Uptake And Metabolism (REACT_78900), Astrocytic Glutamate-Glutamine Uptake And Metabolism (REACT_88210), Amino acid transport across the plasma membrane (REACT_81602), Neurotransmitter Release Cycle (REACT_105010), Neurotransmitter Release Cycle (REACT_102134), SLC-mediated transmembrane transport (REACT_96636), Glutamate Neurotransmitter Release Cycle (REACT_32657).

These properties come from phylome analysis


cellular_component: integral to membrane.

These properties come from blast2go analysis


molecular_function: amino acid transmembrane transporter activity.

cellular_component: integral to membrane.

biological_process: amino acid transport.

Locations

Located in CM3.5_scaffold00009 from 6491040 to 6494049.

This polypeptide in other databases

In PhylomeDB is Phy003A105_CUCME .

Related features