Polypeptide MELO3C008851P1

Accession: MELO3C008851P1

Name: MELO3C008851P1

Description: Similar to Low affinity cationic amino acid transporter 2 (Gallus gallus) (uniprot_sprot:sp|B3TP03|CTR2_CHICK)

Sequence:

>MELO3C008851P1 Similar to Low affinity cationic amino acid transporter 2 (Gallus gallus) (uniprot_sprot:sp|B3TP03|CTR2_CHICK)
MLVRSQSSGDSDVGYGRRLSGVFESLVRRKQVDSENVTRENHHQLAKKLSAIDLVAIGVGATIGAGVYILVGTVAREHAG
PSLAISFLIAGVAAALSAFCYAELACRCPSAGSAYHYTYICVGEGVAWLVGWALILEWTIGGSTVARGITPNLALFLGGQ
DKLPAFLARITIPGLNIVVDPCAAILICIVTALLCIGIKKSSLAQTIVTTINVCALLFIAIVGGYLGFRDGWVGYELPNG
YFPFGVNGMFAGSAVVFFSYIGFDSITSTAEEMKNPQRDLPLGIGLTMLICSILYVITIGAVTALFASLLGSILPQPRIL
MAMARDGLLPSIFADINKHTQVPVKGTIITGLFAAALAFFMDVSQLAGMVSVGTLLAFTTVAISVLILRYVPPHESPLPS
SLQEAINSTLSQLDGESQKTDSNFLGDSSGFHENNIQDSNDEGNDMLSYPLIERQVPREGKRRKTAAWAIALVCLGILIV
TFTASAKYLPSIPRFVSCGVGGVLLLGSLIVLASLDQDDARHSFGHRGGFSCPFVPFLPVACILINSYLLIDLGLATWIR
VSVWFALGALVYTFYGRTHSSLVNAVYVRTNYIDEIYRSSDHVA*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: SLC7A3 (CAT-3)-mediated uptake of cationic amino acids (REACT_14813), SLC7A2, isoform B (CAT-2B)-mediated uptake of cationic amino acids (REACT_106787), SLC7A1 (CAT-1)-mediated uptake of cationic amino acids (REACT_14850), SLC7A2, isoform A (CAT-2A)-mediated uptake of cationic amino acids (REACT_78882), SLC7A2, isoform B (CAT-2B)-mediated uptake of cationic amino acids (REACT_14845), SLC7A3 (CAT-3)-mediated uptake of cationic amino acids (REACT_82027), SLC7A2, isoform A (CAT-2A)-mediated uptake of cationic amino acids (REACT_14848).

biological_process: transmembrane transport, ion transport, cellular nitrogen compound metabolic process, amino acid transport.

REACTOME_PATHWAY: Metabolism of amino acids and derivatives (REACT_13), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_91958), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_19397), SLC-mediated transmembrane transport (REACT_19118), Amino acid transport across the plasma membrane (REACT_90553), Amino acid transport across the plasma membrane (REACT_13796), Amino acid and oligopeptide SLC transporters (REACT_30787), Amino acid and oligopeptide SLC transporters (REACT_19419), Transmembrane transport of small molecules (REACT_15518), Transmembrane transport of small molecules (REACT_86409), Metabolism of amino acids and derivatives (REACT_86268), SLC-mediated transmembrane transport (REACT_98716).

These properties come from phylome analysis


molecular_function: amino acid transmembrane transporter activity.

cellular_component: integral to membrane, vacuolar membrane.

These properties come from blast2go analysis


molecular_function: protein binding.

cellular_component: cytosolic ribosome, chloroplast, plasma membrane, peroxisome, vacuole.

biological_process: transport.

Locations

Located in CM3.5_scaffold00010 from 1293958 to 1302612.

This polypeptide in other databases

In PhylomeDB is Phy003LLUJ_CUCME .

Related features