Polypeptide MELO3C008876P1
Accession: MELO3C008876P1
Name: MELO3C008876P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SIR5)
Sequence:
>MELO3C008876P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SIR5) MDPPAQNTSLQRLQNVEKRIVRVLELAGGVMEELANPAGPRKEFVNNHCSEFMQFIKDIQVTLRDEIKSACEYRPFEKCD YSSRITNELCCKKLEYMISKLDGMKQTIDDYQVKMEDS*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: mediator of RNA polymerase II transcription subunit 11 (K15131).
molecular_function: RNA polymerase II transcription cofactor activity.
These properties come from phylome analysis
molecular_function: RNA polymerase II transcription mediator activity.
cellular_component: mediator complex.
biological_process: regulation of transcription from RNA polymerase II promoter.
These properties come from blast2go analysis
molecular_function: RNA polymerase II transcription mediator activity.
cellular_component: mediator complex.
biological_process: regulation of transcription from RNA polymerase II promoter.
This polypeptide in other databases
In PhylomeDB is Phy003ABBT_CUCME .
