Polypeptide MELO3C009202P1

Accession: MELO3C009202P1

Name: MELO3C009202P1

Description: Similar to PREDICTED: hypothetical protein (Vitis vinifera) (uniref90:UniRef90_UPI0001983CFC)

Sequence:

>MELO3C009202P1 Similar to PREDICTED: hypothetical protein (Vitis vinifera) (uniref90:UniRef90_UPI0001983CFC)
MGLILGKISVETPKYELIQSTSDYEIRKYEPSVVAEVAYDPTQFRGNKDGGFTVLAKYIGAIGEPQNIKSEKVAMTAPVI
TKSEKISMTAPVVTGGGGSEGKPVTMQFVLPSKYKKAEEAPKPADERVVIKEEGERKLAVVRFSGIATEGVVAEKVEQLK
KSLEKDGHKVIGDYVLARYNPPWTLPSLRTNEVMIPVE*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Liganded Gi-activating GPCRs bind inactive heterotrimeric G-protein Gi (REACT_22289), The Ligand:GPCR:Gi complex dissociates (REACT_22239), FPRL2 receptor binds a wide range of ligands (REACT_21406), Liganded Gi-activating GPCR acts as a GEF for Gi (REACT_15538).

REACTOME_COMPLEX: Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (active) [plasma membrane] (REACT_23190), Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (inactive) [plasma membrane] (REACT_22813), FPRL2:FPRL2 ligands [plasma membrane] (REACT_21978).

REACTOME_PATHWAY: Formyl peptide receptors bind formyl peptides and many other ligands (REACT_21264), Class A/1 (Rhodopsin-like receptors) (REACT_14828), GPCR ligand binding (REACT_21340), Peptide ligand-binding receptors (REACT_14819), Signaling by GPCR (REACT_14797), G alpha (i) signalling events (REACT_19231), GPCR downstream signaling (REACT_19184).

These properties come from phylome analysis


cellular_component: plasma membrane, vacuole.

biological_process: red or far-red light signaling pathway.

Locations

Located in CM3.5_scaffold00011 from 706110 to 706706.

This polypeptide in other databases

In PhylomeDB is Phy003A3UL_CUCME .

Related features