Polypeptide MELO3C009269P1
Accession: MELO3C009269P1
Name: MELO3C009269P1
Description: Similar to ADP-ribosylation factor GTPase-activating protein AGD7 (Arabidopsis thaliana) (uniprot_sprot:sp|O80925|AGD7_ARATH)
Sequence:
>MELO3C009269P1 Similar to ADP-ribosylation factor GTPase-activating protein AGD7 (Arabidopsis thaliana) (uniprot_sprot:sp|O80925|AGD7_ARATH) MAASRRLRDLQSRPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNEQL NAFLAQYGIPKETDIVTKYNTSAAGVYRDRIQALAEGRSWKDPPAVKENIGVGKSRPPLAQSAGGGGSKVNNGGWDSWDN DDNFRSSSDMRRNQSTGDVRGTGGGGMPSRSRSTEDIYTRAQLEASAANKDNFFARKIAENDSRPEGIPPSQGGKYVGFG SSPTPARRNDPQNDVFSVVSQGFGKLSLVAASAAQSAANAVQAGTKELTTKVKEGGYDYKVNETVNVVTAKTTEIGQRTW GIMRGVMAMASQKVEEYAKDGMNWKNDGWQRNENEKNGYYQEFEHDNKGWNSSSGTGQSSGSGHHNNSYNSSSWDDWDTK DNRKEETTTKVSGTHNNNNNNSNDGWAGWDDQKDDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: zinc ion binding, ARF GTPase activator activity.
cellular_component: mitochondrion.
biological_process: regulation of ARF GTPase activity.
These properties come from reactome analysis
REACTOME_REACTION: Sculpting and pinching-off of Golgi vessicle (REACT_28200), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_89009).
biological_process: COPI coating of Golgi vesicle, cellular membrane organization, retrograde vesicle-mediated transport, Golgi to ER.
REACTOME_PATHWAY: COPI Mediated Transport (REACT_82601), Membrane Trafficking (REACT_87431), Golgi to ER Retrograde Transport (REACT_84617).
These properties come from phylome analysis
molecular_function: identical protein binding, actin binding, zinc ion binding, ARF GTPase activator activity.
cellular_component: perinuclear region of cytoplasm, cytoskeleton, trans-Golgi network, ER-Golgi intermediate compartment, endosome, mitochondrion.
biological_process: Golgi to plasma membrane protein transport, actin filament reorganization involved in cell cycle, retrograde vesicle-mediated transport, Golgi to ER, ER to Golgi vesicle-mediated transport, regulation of ARF GTPase activity.
These properties come from kegg analysis
KEGG_ORTHOLOGS: ADP-ribosylation factor GTPase-activating protein 1 (K12492).
This polypeptide in other databases
In PhylomeDB is Phy003A5WK_CUCME .

