Polypeptide MELO3C009269P1

Accession: MELO3C009269P1

Name: MELO3C009269P1

Description: Similar to ADP-ribosylation factor GTPase-activating protein AGD7 (Arabidopsis thaliana) (uniprot_sprot:sp|O80925|AGD7_ARATH)

Sequence:

>MELO3C009269P1 Similar to ADP-ribosylation factor GTPase-activating protein AGD7 (Arabidopsis thaliana) (uniprot_sprot:sp|O80925|AGD7_ARATH)
MAASRRLRDLQSRPGNKICVDCSQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNEQL
NAFLAQYGIPKETDIVTKYNTSAAGVYRDRIQALAEGRSWKDPPAVKENIGVGKSRPPLAQSAGGGGSKVNNGGWDSWDN
DDNFRSSSDMRRNQSTGDVRGTGGGGMPSRSRSTEDIYTRAQLEASAANKDNFFARKIAENDSRPEGIPPSQGGKYVGFG
SSPTPARRNDPQNDVFSVVSQGFGKLSLVAASAAQSAANAVQAGTKELTTKVKEGGYDYKVNETVNVVTAKTTEIGQRTW
GIMRGVMAMASQKVEEYAKDGMNWKNDGWQRNENEKNGYYQEFEHDNKGWNSSSGTGQSSGSGHHNNSYNSSSWDDWDTK
DNRKEETTTKVSGTHNNNNNNSNDGWAGWDDQKDDGYDHYYQASDRKTVGQNGKAGGGTWSEGGFL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: zinc ion binding, ARF GTPase activator activity.

cellular_component: mitochondrion.

biological_process: regulation of ARF GTPase activity.

These properties come from reactome analysis


REACTOME_REACTION: Sculpting and pinching-off of Golgi vessicle (REACT_28200), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_89009).

biological_process: COPI coating of Golgi vesicle, cellular membrane organization, retrograde vesicle-mediated transport, Golgi to ER.

REACTOME_PATHWAY: COPI Mediated Transport (REACT_82601), Membrane Trafficking (REACT_87431), Golgi to ER Retrograde Transport (REACT_84617).

These properties come from phylome analysis


molecular_function: identical protein binding, actin binding, zinc ion binding, ARF GTPase activator activity.

cellular_component: perinuclear region of cytoplasm, cytoskeleton, trans-Golgi network, ER-Golgi intermediate compartment, endosome, mitochondrion.

biological_process: Golgi to plasma membrane protein transport, actin filament reorganization involved in cell cycle, retrograde vesicle-mediated transport, Golgi to ER, ER to Golgi vesicle-mediated transport, regulation of ARF GTPase activity.

These properties come from kegg analysis


KEGG_ORTHOLOGS: ADP-ribosylation factor GTPase-activating protein 1 (K12492).

Locations

Located in CM3.5_scaffold00011 from 1075272 to 1077213.

This polypeptide in other databases

In PhylomeDB is Phy003A5WK_CUCME .

Related features