Polypeptide MELO3C009300P2

Accession: MELO3C009300P2

Name: MELO3C009300P2

Description: Similar to Protein IN2-1 homolog B (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q8H8U5|IN21B_ORYSJ)

Sequence:

>MELO3C009300P2 Similar to Protein IN2-1 homolog B (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q8H8U5|IN21B_ORYSJ)
MAALREEVLPPSLDATAEQPPLFDGTTRLYTAYICPYAQRVWIIRNYKGLQDKIKLVPLNLYNRPDWYKEKVYPLNKVPS
LEHNGKVIGESLDLIKYVDGNFEGPSLLPDDPAKREYAEELLSYSDTFVSSIISSFKGDTAKEAGAQFDYLENALQKFDG
PFFLGEISQVDIAYVPFVERYQVFLFEAFKIDITEGRPKLAAWIEEFNKNDAYKQTKYDPKAIVEHYKKRFLVPYVS*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Reduction of dehydroascorbate to ascorbate (REACT_107653), Reduction of dehydroascorbate to ascorbate (REACT_11095), Glutathione conjugation of cytosolic substrates (REACT_78100), Glutathione conjugation of cytosolic substrates (REACT_6854).

biological_process: xenobiotic metabolic process, water-soluble vitamin metabolic process, vitamin metabolic process.

REACTOME_COMPLEX: GSTO1 homodimer [cytosol] (REACT_11608), Cytosolic GST homodimer [cytosol] (REACT_7392), GSTO2 homodimer [cytosol] (REACT_11325).

REACTOME_PATHWAY: Metabolism of water-soluble vitamins and cofactors (REACT_11238), Biological oxidations (REACT_90526), Metabolism of water-soluble vitamins and cofactors (REACT_28813), Vitamin C (ascorbate) metabolism (REACT_11202), Biological oxidations (REACT_13433), Phase II conjugation (REACT_31665), Metabolism of vitamins and cofactors (REACT_78899), Phase II conjugation (REACT_6959), Vitamin C (ascorbate) metabolism (REACT_81219), Glutathione conjugation (REACT_6926), Metabolism of vitamins and cofactors (REACT_11193), Glutathione conjugation (REACT_101447).

These properties come from blast2go analysis


molecular_function: glutathione transferase activity.

cellular_component: cytoplasm.

biological_process: metabolic process.

Locations

Located in CM3.5_scaffold00011 from 1266031 to 1268196.

This polypeptide in other databases

In PhylomeDB is Phy003MHAC_CUCME .

Related features