Polypeptide MELO3C009702P1

Accession: MELO3C009702P1

Name: MELO3C009702P1

Description: Similar to NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Dictyostelium discoideum) (uniprot_sprot:sp|Q54I90|NDUV1_DICDI)

Sequence:

>MELO3C009702P1 Similar to NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Dictyostelium discoideum) (uniprot_sprot:sp|Q54I90|NDUV1_DICDI)
MAPFRGMLYLQHRTLARRYIDQWGIGLRAFSSQGAAAPGSPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAM
KRGDWHRTKDLVLKGADWIVNEVKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHK
LLEGCLIAGVGMRATAAYIYIRGEYVNERKNLEKARKEAYEAGLLGKNACGSGYDFDVHIHYGAGAYICGEETALLESLE
GKQGKPRLKPPFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFASFGRKNNSGTKLFCVSGHVNKPCTVEEEMSIPLK
ELIERHCGGVRGGWDNLLAVIPGGSSVPLLPKHICDDVLMDYDALKAVQSGLGTAAVIVMDKSTDIVDAIARLSYFYKHE
SCGQCTPCREGTGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICALGDAAAWPVQGLIKNFRPELERRIRERAERE
LIQAAA*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: 4 iron, 4 sulfur cluster binding, NAD binding, FMN binding, NADH dehydrogenase (ubiquinone) activity.

cellular_component: mitochondrion.

biological_process: oxidation-reduction process.

These properties come from reactome analysis


REACTOME_REACTION: NADH enters the respiratory chain at Complex I (REACT_98202), NADH enters the respiratory chain at Complex I (REACT_6310).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393), Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_101166), Respiratory electron transport (REACT_30834).

REACTOME_COMPLEX: FP sub-complex [mitochondrial inner membrane] (REACT_6488), Complex I - 51 kDa subunit-FMN-4Fe-4S cluster complex [mitochondrial inner membrane] (REACT_6466), Complex I - NADH:Ubiquinone oxidoreductase [mitochondrial inner membrane] (REACT_6533).

biological_process: respiratory electron transport chain.

These properties come from phylome analysis


molecular_function: metal ion binding, 4 iron, 4 sulfur cluster binding, NAD binding, FMN binding, NADH dehydrogenase (ubiquinone) activity.

cellular_component: mitochondrial respiratory chain complex I, mitochondrion.

biological_process: embryonic morphogenesis, dauer exit, pharyngeal pumping, response to drug, inductive cell migration, positive regulation of multicellular organism growth, positive regulation of growth rate, growth, mitochondrial respiratory chain complex assembly, defecation, lipid storage, embryo development ending in birth or egg hatching, gonad development, determination of adult lifespan, transport, mitochondrial electron transport, NADH to ubiquinone, oxidation-reduction process.

These properties come from kegg analysis


KEGG_ORTHOLOGS: NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:1.6.5.3 1.6.99.3] (K03942).

molecular_function: NADH dehydrogenase activity, NADH dehydrogenase (ubiquinone) activity.

Locations

Located in CM3.5_scaffold00011 from 4257852 to 4259740.

This polypeptide in other databases

In PhylomeDB is Phy0039YL4_CUCME .

Related features