Polypeptide MELO3C009724P1

Accession: MELO3C009724P1

Name: MELO3C009724P1

Description: Similar to Aladin (Mus musculus) (uniprot_sprot:sp|P58742|AAAS_MOUSE)

Sequence:

>MELO3C009724P1 Similar to Aladin (Mus musculus) (uniprot_sprot:sp|P58742|AAAS_MOUSE)
MPSFPPPGSVTICEINRDLITADCLSDDRANDTYGKVLGMVFSPVPFQSDFLVSPTPEPKNEPRNDEANGEIIQRKGVIA
SLQGFIEGSINRFLRPNDVKYLPTEYLQGVSWHQHKHIIAFISGTNQVVVHDYENAEGKDPCILTHDLQRDVKVLEWRPN
GGRTLSVACKGGICIWAASFPGNAASVRPGAVSFLGSFSRGSGVRYTLVDFLRSHDEQISALSWSPNGRYLASATYDSSS
FTIWDVAQGLGTPIRRGLGCVSTIKWSPTGDYFFAAKFDGTFYLWETNAWTSEQWSSTSGFVTGAIWDPEGRMILLAFSD
SSVLGSIHFASKPPSLVAHLLPVDLPEITTLTNSQGIEKIAWDASGERLAVSFKDGDELYNGLIAVYDVKRTPLICPSLI
GFIRGPGDNPKPVAFSFHGKFKQGPLLSVCWSSGFCCTYPLIFRSHVVP*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Rev multimer-bound HIV-1 mRNA:Crm1:Ran:GTP complex associates with the NPC (REACT_6337), Translocation of Rev:importin-beta:B23 to the nucleus (REACT_9521), Rev:importin beta:B23 recruited to the nuclear pore (REACT_9516), GCK1:GKRP [cytosol] => GCK1:GKRP [nucleoplasm] (REACT_6938), Translocation of nuclear RNA transport complex to cytoplasm (REACT_6340), Vpr binds nucleoporins (REACT_7952).

biological_process: hexose transport, transmembrane transport, viral reproduction, glucose transport, regulation of glucose transport, carbohydrate metabolic process.

REACTOME_COMPLEX: PIC anchored to the NPC [nuclear envelope] (REACT_8912), Nuclear Pore Complex (NPC) [nuclear envelope] (REACT_5542), Rev multimer-bound HIV-1 mRNA:Crm1:Ran:GTP:NPC [nuclear envelope] (REACT_6537), nucleoporin-associated Rev:Importin-beta:B23 complex [nuclear envelope] (REACT_9793).

REACTOME_PATHWAY: HIV Infection (REACT_6185), Rev-mediated nuclear export of HIV-1 RNA (REACT_6190), Hexose transport (REACT_9441), SLC-mediated transmembrane transport (REACT_19118), Host Interactions of HIV factors (REACT_6288), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_6804), Glucose transport (REACT_212), Nuclear import of Rev protein (REACT_9395), Metabolism of carbohydrates (REACT_474), Interactions of Vpr with host cellular proteins (REACT_6757), Interactions of Rev with host cellular proteins (REACT_6916), Transmembrane transport of small molecules (REACT_15518), Vpr-mediated nuclear import of PICs (REACT_7991), HIV Life Cycle (REACT_6256), Late Phase of HIV Life Cycle (REACT_6361).

These properties come from phylome analysis


molecular_function: protein binding.

cellular_component: nuclear pore, nuclear envelope.

biological_process: transmembrane transport, regulation of nucleocytoplasmic transport, viral reproduction, glucose transport, regulation of glucose transport, nucleocytoplasmic transport, carbohydrate metabolic process.

These properties come from kegg analysis


KEGG_ORTHOLOGS: aladin (K14320).

Locations

Located in CM3.5_scaffold00011 from 4437759 to 4442386.

This polypeptide in other databases

In PhylomeDB is Phy003LLB3_CUCME .

Related features