Polypeptide MELO3C009742P1
Accession: MELO3C009742P1
Name: MELO3C009742P1
Description: Similar to V-type proton ATPase subunit H (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LX65|VATH_ARATH)
Sequence:
>MELO3C009742P1 Similar to V-type proton ATPase subunit H (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LX65|VATH_ARATH) MAIDQAELSTEQVLTRDIPWETYMSTKLISGTSLQLLRRYDNRPESYRAQLLDDDGPAYVRVFVSILRDIFKEETVEYVL ALIDEMLTANPKRARLFHDPSLASEDAYEPFLRLLWKGNWFIQEKSCKILALIVSARPKTHDGSFANDDASNSKNKNTTI DDVLDGLVKWLCAQLKNPSHPSRAVQTSINCLATLLKEPKVRSSFVQTDGVKLLIPLISPASTQQSIQLLYETCLCVWLL SYYEPAIEFLATSRTLPRLIDVVKSSTKEKVVRVIILTLRNLLHKGTFGAQMVGLGLPQIVQSLKSQAWSDEDLLEALNQ LEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDVNFWRENIMSFEENDLKILRVLITILDSSKVIQGLWQLLVLIFLS SFNTIQLGEL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: proton-transporting ATPase activity, rotational mechanism, heme binding, hydrogen-exporting ATPase activity, phosphorylative mechanism.
cellular_component: vacuolar proton-transporting V-type ATPase, V1 domain.
biological_process: ATP synthesis coupled proton transport.
These properties come from reactome analysis
REACTOME_REACTION: Acidification of Tf:TfR1 containing endosome (REACT_25268), Formation of CD8:Nef:AP-2 Complex:v-ATPase Complex (REACT_11125), Endosome acidification (REACT_2002), Endosome acidification (REACT_86695), Internalization of the CD8:Nef:AP-2 Complex:v-ATPase Complex (REACT_11069), Internalization of the CD4:Nef:AP-2 Complex:v-ATPase Complex (REACT_11160), Endosome acidification (REACT_97023), Formation of CD4:Nef:AP-2 Complex:v-ATPase Complex (REACT_11091), Endosome acidification (REACT_95835).
biological_process: transmembrane transport, regulation of defense response to virus by virus, transferrin transport, viral reproduction, insulin receptor signaling pathway, cellular iron ion homeostasis.
REACTOME_COMPLEX: CD8:Nef:AP-2 Complex:v-ATPase Complex [cytosol, plasma membrane] (REACT_11369), CD4:Nef:AP-2 Complex:v-ATPase Complex [cytosol, plasma membrane] (REACT_11339), Internalized CD8:Nef:Clathrin-Coated Pit Adapter Protein:v-ATPase [cytosol, early endosome membrane] (REACT_11305), V-ATPase [endosome membrane] (REACT_24332), ATP6V1 [cytosol] (REACT_24241), Internalized CD4:Nef:Clathrin-Coated Pit Adapter Protein:v-ATPase [cytosol, early endosome membrane] (REACT_11967).
REACTOME_PATHWAY: Nef Mediated CD8 Down-regulation (REACT_11200), Signaling by Insulin receptor (REACT_6313), Insulin receptor recycling (REACT_109826), The role of Nef in HIV-1 replication and disease pathogenesis (REACT_6835), Insulin receptor recycling (REACT_1109), Signaling by Insulin receptor (REACT_498), Insulin receptor recycling (REACT_92916), Transmembrane transport of small molecules (REACT_15518), HIV Infection (REACT_6185), Insulin receptor recycling (REACT_81064), Host Interactions of HIV factors (REACT_6288), Transferrin endocytosis and recycling (REACT_25283), Iron uptake and transport (REACT_25060), Signaling by Insulin receptor (REACT_78672), Nef Mediated CD4 Down-regulation (REACT_11166), Nef-mediates down modulation of cell surface receptors by recruiting them to clathrin adapters (REACT_11149), Signaling by Insulin receptor (REACT_97488).
These properties come from phylome analysis
molecular_function: enzyme regulator activity, protein binding, binding, proton-transporting ATPase activity, rotational mechanism, heme binding.
cellular_component: chloroplast, plasma membrane, cytosol, plant-type vacuole, vacuolar proton-transporting V-type ATPase, V1 domain.
biological_process: regulation of defense response to virus by virus, interspecies interaction between organisms, transferrin transport, dsRNA transport, viral reproduction, ATP hydrolysis coupled proton transport, determination of adult lifespan, insulin receptor signaling pathway, vacuolar acidification, endocytosis, cellular iron ion homeostasis, ATP synthesis coupled proton transport.
These properties come from kegg analysis
KEGG_ORTHOLOGS: V-type H+-transporting ATPase 54 kD subunit [EC:3.6.3.14] (K02144).
molecular_function: hydrogen ion transporting ATP synthase activity, rotational mechanism, proton-transporting ATPase activity, rotational mechanism.
This polypeptide in other databases
In PhylomeDB is Phy003AEUV_CUCME .
