Polypeptide MELO3C010034P1
Accession: MELO3C010034P1
Name: MELO3C010034P1
Sequence:
>MELO3C010034P1 MESASKSLIVPMPKLFSNLSYDFRATIETIKVEMFEMKMQVNLTMQAVGNQTLNQVYNVSSRLKILEHKAFNENSDAKEL ENLIFDMEQYFKASGSNSEKP
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: binding.
This polypeptide in other databases
In PhylomeDB is Phy003MF37_CUCME .

