Polypeptide MELO3C010035P1
Accession: MELO3C010035P1
Name: MELO3C010035P1
Description: Similar to Zinc finger CCCH domain-containing protein 16 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FWS3|C3H16_ARATH)
Sequence:
>MELO3C010035P1 Similar to Zinc finger CCCH domain-containing protein 16 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FWS3|C3H16_ARATH) MHYKKQHCRNFQRGSCQYGEGCKFLHATQQAPQQKPNPFGFGVPNNGQSKAVADFGSKQNQFKPFENKWTRPSTPTGNAQ SRKPDNHLPSSNHKCTDGESCKRQIAEDFQNERPLWKLTCYGHNKNEPCDIVGDVSYEELRTIAYDEAKRGISLQSIVER ERNLLNSKLAEFEGLLHKPYVTPSNRAPGNQSSFSGTNSPSILPSAQNNTPSLSSFSQLGASLNTGFGARPSNSPNTVFG QQFQFSSPVQNSSGFGMTNFPSTSVVAVGVGSQTFGNLSTPSGFNNNGIANAGSNIFSSATLTNLPPMNANSSASGQIAP NAQLVNKLQQENSSVDVGIWMKEKWVPGEIPEMAPPDAVVQ*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: nucleoporin-like protein 2 (K14321).
These properties come from blast2go analysis
molecular_function: binding.
cellular_component: intracellular membrane-bounded organelle.
biological_process: cellular component organization, cellular process.

