Polypeptide MELO3C010381P1

Accession: MELO3C010381P1

Name: MELO3C010381P1

Description: Similar to 2-hydroxyacyl-CoA lyase (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LF46|HACL_ARATH)

Sequence:

>MELO3C010381P1 Similar to 2-hydroxyacyl-CoA lyase (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LF46|HACL_ARATH)
MGDSAEALQNDLRFHGPIDGNVLAAMALARCGVDRMFGVVGIPVTSLATRAVSLGIRFIAFHNEQSAGYAASAYGYLTGR
PGVLLTVSGPGCVHGLAGISNAMVNAWPLVMISGSCDQRDFGRGDFQELDQVEAVKPFSKISVKATDISEIPNCVARVLN
SAVSGRPGGCYFDLPSDVLHQTISESEAERLLAAAEEFANREVIPRVPNSQIEEAISLLKHAERPLIVFGKGAAIARAEG
PLKKLVETTGIPFLPTPMGKGLLPDTHELAATAARSLAIGKCDVALVVGARLNWLLHFGEPPKWSKDVKFILVDICKEEV
ELRKPHLGLIGDAKEVLESINKEIKDDPFCLGKSHPWVGAISQKAKDNVAKMEVQLAKDVVPFNFLTPMRIIRDAILAVG
SPAPILVSEGANTMDVGRSVLVQTEPRTRLDAGTWGTMGVGLGYCIAAAVASPDRLVVAVEGDSGFGFSAMEVETLVRYE
LPVVVIVFNNSGVYGGDRRTPQEITGPYKHDPAPTSFVPSASYDKMIEAFGGKGYYVESPEELKSALAESFSARKPAVVN
VKIDPYAGAESGRLQHKN*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: thiamine pyrophosphate binding, transferase activity, oxalyl-CoA decarboxylase activity, pyruvate decarboxylase activity, magnesium ion binding.

These properties come from reactome analysis


REACTOME_REACTION: 2-hydroxyphytanoyl-CoA => pristanal + formyl-CoA (REACT_17035), 2-hydroxyphytanoyl-CoA => pristanal + formyl-CoA (REACT_79421), 2-hydroxyphytanoyl-CoA => pristanal + formyl-CoA (REACT_83933), 2-hydroxyphytanoyl-CoA => pristanal + formyl-CoA (REACT_101892), 2-hydroxyphytanoyl-CoA => pristanal + formyl-CoA (REACT_91730), 2-hydroxyphytanoyl-CoA => pristanal + formyl-CoA (REACT_95341).

biological_process: cellular lipid metabolic process, fatty acid alpha-oxidation.

REACTOME_COMPLEX: HACL1 tetramer [peroxisomal matrix] (REACT_17962), HACL1 holoenzyme monomer [peroxisomal matrix] (REACT_17150).

REACTOME_PATHWAY: Metabolism of lipids and lipoproteins (REACT_79403), Metabolism of lipids and lipoproteins (REACT_106721), Peroxisomal lipid metabolism (REACT_79191), Metabolism of lipids and lipoproteins (REACT_22258), Peroxisomal lipid metabolism (REACT_94360), Alpha-oxidation of phytanate (REACT_17003), Peroxisomal lipid metabolism (REACT_81319), Peroxisomal lipid metabolism (REACT_82818), Metabolism of lipids and lipoproteins (REACT_104203), Alpha-oxidation of phytanate (REACT_83317), Alpha-oxidation of phytanate (REACT_109097), Metabolism of lipids and lipoproteins (REACT_81798), Peroxisomal lipid metabolism (REACT_16957), Alpha-oxidation of phytanate (REACT_87835), Metabolism of lipids and lipoproteins (REACT_109614), Alpha-oxidation of phytanate (REACT_29885), Alpha-oxidation of phytanate (REACT_106518), Peroxisomal lipid metabolism (REACT_98520).

These properties come from phylome analysis


molecular_function: identical protein binding, carboxy-lyase activity, carbon-carbon lyase activity, lyase activity, protein binding, catalytic activity, thiamine pyrophosphate binding, transferase activity, oxalyl-CoA decarboxylase activity, magnesium ion binding.

cellular_component: peroxisomal matrix, peroxisome, cytoplasm.

biological_process: fatty acid alpha-oxidation.

These properties come from kegg analysis


KEGG_ORTHOLOGS: 2-hydroxyacyl-CoA lyase 1 [EC:4.1.-.-] (K12261).

Locations

Located in CM3.5_scaffold00013 from 469304 to 472313.

This polypeptide in other databases

In PhylomeDB is Phy003A97I_CUCME .

Related features