Polypeptide MELO3C010454P1
Accession: MELO3C010454P1
Name: MELO3C010454P1
Description: Similar to Probable calcium-binding protein CML29 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q5Z676|CML29_ORYSJ)
Sequence:
>MELO3C010454P1 Similar to Probable calcium-binding protein CML29 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q5Z676|CML29_ORYSJ) MPKSILQYTHIPTLIQTMAQAGSLLVDTEALSHIFNLIEAFRAFDADNDGLISSAEVGGIVGSLGYNLSEEDVKMMMEEG DADKDGLLSMGEFLEMNAKNMEVGELGSYLKIALEALKADGDDLVSGEELYDVFVNLGLDVSLEDSMAIVASLDGDGDGA MFLHDFKLIVNSLH*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Calmodulin binds CaMK IV (REACT_15339), NO biosynthesis (REACT_86943), Phosphorylation of Smooth Muscle Myosin Light Chains (REACT_20597), Akt phosphorylates eNOS (REACT_12415), CamKIV enters the nucleus (REACT_15332), kainate receptor binds glutamate (REACT_21269), Calcium binds calmodulin (REACT_104609), CaMK IV phosphorylates CREB (REACT_15427), Ras activation (REACT_20612), Caveolin-1 dissociates from eNOS:CaM:HSP90 complex (REACT_12459), eNOS:Caveolin-1 complex binds to CaM (REACT_12620), Inhibition of GRK2 by calmodulin (REACT_15422), Calcium binds calmodulin (REACT_12602), Inactive catalytic PP2B is activated by the binding of calmodulin (REACT_15299), Release of platelet cytosolic components (REACT_21347), Akt phosphorylates eNOS (REACT_32370), Phosphorylation of CREB by CaMKIV (REACT_20666), Akt binds eNOS complex via HSP90 (REACT_12382), glycogen phosphorylase (PYGM) dimer b + 2 ATP => glycogen phosphorylase (PYGM) dimer a + 2 ADP (REACT_848), HSP90 binds eNOS:Caveolin-1:CaM complex (REACT_12426), DARPP-32 is dephosphorylated on Thr34 by PP2B (REACT_15494), CaMK IV autophosphorylation (REACT_15320), NO biosynthesis (REACT_12443), glycogen phosphorylase (PYGL) dimer b + 2 ATP => glycogen phosphorylase (PYGL) dimer a + 2 ADP (REACT_1623), Activation of Ca-permeable Kainate receptors (REACT_21414), Activation of RasGRF (REACT_20670), MLCK Active Calmodulin Binding (REACT_20521), Calcium binds calmodulin (REACT_88358), glycogen phosphorylase (PYGB) dimer b + 2 ATP => glycogen phosphorylase (PYGB) dimer a + 2 ADP (REACT_21331), Inhibition of GRK2 by calmodulin (REACT_88729), Activation of CaMKII (REACT_20634).
biological_process: activation of phospholipase C activity, carbohydrate metabolic process, glucose metabolic process, synaptic transmission, muscle contraction, regulation of nitric-oxide synthase activity, nerve growth factor receptor signaling pathway, platelet activation, platelet degranulation, glycogen catabolic process, nitric oxide metabolic process, blood coagulation.
REACTOME_COMPLEX: Active Calmodulin [nucleoplasm] (REACT_23175), GRK2:calmodulin [plasma membrane] (REACT_17570), Active Calmodulin [plasma membrane] (REACT_23058), Kainate receptor-glutamate complex [plasma membrane, extracellular region] (REACT_22077), Phospho-eNOS (S1177):CaM:HSP90:Phospho-Akt1 [plasma membrane] (REACT_12662), phospho-CaMK IV:Calmodulin [nucleoplasm] (REACT_15743), active Calmodulin [nucleoplasm] (REACT_15760), Calmodulin:CaMK IV [nucleoplasm] (REACT_15747), phosphorylase kinase complex (PHKL) [cytosol] (REACT_4025), GRIK2 interacting proteins [plasma membrane] (REACT_21432), PP2B complex [cytosol] (REACT_17149), eNOS:CaM:HSP90:Phospho-AKT1 [plasma membrane] (REACT_12902), PP2B catalytic (Fe3+, Zn2+):Active Calmodulin [cytosol] (REACT_17373), active Calmodulin [cytosol] (REACT_10340), Calmodulin:CaMK IV [cytosol] (REACT_15739), eNOS:Caveolin-1:CaM [plasma membrane] (REACT_12757), GRIK 2 homomer [plasma membrane] (REACT_21798), RasGRF:Ca/calmodulin [plasma membrane, extracellular region, cytosol] (REACT_21180), eNOS:Caveolin-1:CaM:HSP90 [plasma membrane] (REACT_12971), Active Calmodulin [cytosol] (REACT_3178), eNOS:CaM:HSP90 [plasma membrane] (REACT_12871), MLCK:Calcium:Calmodulin [cytosol] (REACT_20833), CaMKII-Ca2+/Calmodulin [plasma membrane, cytosol] (REACT_20912), phosphorylase kinase complex (PHKM) [cytosol] (REACT_5518).
REACTOME_PATHWAY: Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_15370), CaM pathway (REACT_95324), Glucose metabolism (REACT_723), Opioid Signalling (REACT_106208), eNOS activation (REACT_12477), DARPP-32 events (REACT_15334), Ras activation uopn Ca2+ infux through NMDA receptor (REACT_20546), Hemostasis (REACT_604), Post NMDA receptor activation events (REACT_20593), Signalling by NGF (REACT_82110), PLC-gamma1 signalling (REACT_12079), Smooth Muscle Contraction (REACT_97034), CaMK IV-mediated phosphorylation of CREB (REACT_15502), Synaptic Transmission (REACT_13685), Transmission across Chemical Synapses (REACT_13477), Smooth Muscle Contraction (REACT_20558), eNOS activation and regulation (REACT_12389), Glycogen breakdown (glycogenolysis) (REACT_1008), PLC beta mediated events (REACT_15426), Response to elevated platelet cytosolic Ca2+ (REACT_1280), CREB phosphorylation through the activation of CaMKK (REACT_20661), Ca-dependent events (REACT_89441), NGF signalling via TRKA from the plasma membrane (REACT_100895), eNOS activation and regulation (REACT_88732), Opioid Signalling (REACT_15295), Muscle contraction (REACT_17044), CREB phosphorylation through the activation of CaMKII (REACT_20642), Calmodulin induced events (REACT_9000), Ionotropic activity of Kainate Receptors (REACT_21322), G-protein mediated events (REACT_15526), NGF signalling via TRKA from the plasma membrane (REACT_12056), PLC-gamma1 signalling (REACT_81004), Signalling by NGF (REACT_97378), Metabolism of nitric oxide (REACT_12508), NGF signalling via TRKA from the plasma membrane (REACT_29880), Ca-dependent events (REACT_84461), Ca-dependent events (REACT_15307), PLC-gamma1 signalling (REACT_34721), G-protein mediated events (REACT_81829), Platelet Activation (REACT_798), Smooth Muscle Contraction (REACT_80035), Opioid Signalling (REACT_32504), eNOS activation (REACT_84429), PLC beta mediated events (REACT_80001), Activation of Ca-permeable Kainate Receptor (REACT_21346), Calmodulin induced events (REACT_88136), Activation of NMDA receptor upon glutamate binding and postsynaptic events (REACT_20563), G-protein mediated events (REACT_99045), CREB phosphorylation through the activation of Ras (REACT_20568), Metabolism of carbohydrates (REACT_474), Platelet degranulation (REACT_318), Activation of CaMK IV (REACT_20652), Muscle contraction (REACT_29281), Activation of Kainate Receptors upon glutamate binding (REACT_21312), Metabolism of nitric oxide (REACT_31937), Signalling by NGF (REACT_11061), CaM pathway (REACT_88763), PLC beta mediated events (REACT_30626), CaM pathway (REACT_9053), Formation of Platelet plug (REACT_20), Muscle contraction (REACT_99378).
These properties come from phylome analysis
molecular_function: calcium ion binding.
These properties come from blast2go analysis
molecular_function: calcium ion binding.
cellular_component: cytoplasm.
biological_process: response to cold.
This polypeptide in other databases
In PhylomeDB is Phy003AE0U_CUCME .

