Polypeptide MELO3C010538P1
Accession: MELO3C010538P1
Name: MELO3C010538P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_87.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TFE1)
Sequence:
>MELO3C010538P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_87.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TFE1) MELPRFTRPNQHNGSSSSPILYVANCGPAVGISHPTIAAVFAHFGHVKGVHAADDTGARVIVCFSEESSAQAALETLHGR PCPLLGGRTLHIRYSIIRPSISQPNDSVSVSLSASELDIPGLFLLHDFVNAKEEEDLLREVDARPWNNLAKRRVQHYGYE FCYQTRNVNTKHQLGELPPFVSHVVDRISLFPNTEDVADASLDQLTIDMVKDSSIRRAPRRVSFTFRKVRTDPCQCKFPH YCDSQR*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: Rho guanyl-nucleotide exchange factor activity, nucleic acid binding.

