Polypeptide MELO3C010538P2
Accession: MELO3C010538P2
Name: MELO3C010538P2
Description: Similar to Alkylated DNA repair protein alkB homolog 8 (Xenopus tropicalis) (uniprot_sprot:sp|Q07G10|ALKB8_XENTR)
Sequence:
>MELO3C010538P2 Similar to Alkylated DNA repair protein alkB homolog 8 (Xenopus tropicalis) (uniprot_sprot:sp|Q07G10|ALKB8_XENTR) MELPRFTRPNQHNGSSSSPILYVANCGPAVGISHPTIAAVFAHFGHVKGVHAADDTGARVIVCFSEESSAQAALETLHGR PCPLLGGRTLHIRYSIIRPSISQPNDSVSVSLSASELDIPGLFLLHDFVNAKEEEDLLREVDARPWNNLAKRRVQHYGYE FCYQTRNVNTKHQLGELPPFVSHVVDRISLFPNTEDVADASLDQLTVNEYPPGVGLSPHIDTHSAFEGLIFSLSLAGPCI MEFRRYPEGAWHEFPLSIDLKMENSVNDSNYLRKAIYLPPRSMLLLSGEARYAWHHYIPHHKIDMVKDSSIRRAPRRVSF TFRKVRTDPCQCKFPHYCDSQR*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: oxidoreductase activity, iron ion binding, Rho guanyl-nucleotide exchange factor activity, nucleic acid binding, nucleotide binding.
biological_process: oxidation-reduction process.
These properties come from phylome analysis
molecular_function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen, oxidoreductase activity, nucleic acid binding, nucleotide binding.
biological_process: oxidation-reduction process.
This polypeptide in other databases
In PhylomeDB is Phy003LJY8_CUCME .

