Polypeptide MELO3C010538P3
Accession: MELO3C010538P3
Name: MELO3C010538P3
Description: Similar to Alkylated DNA repair protein alkB homolog 8 (Xenopus tropicalis) (uniprot_sprot:sp|Q07G10|ALKB8_XENTR)
Sequence:
>MELO3C010538P3 Similar to Alkylated DNA repair protein alkB homolog 8 (Xenopus tropicalis) (uniprot_sprot:sp|Q07G10|ALKB8_XENTR) MELPRFTRPNQHNGSSSSPILYVANCGPAVGISHPTIAAVFAHFGHVKGVHAADDTGARVIVCFSEESSAQAALETLHGR PCPLLGGRTLHIRYSIIRPSISQPNDSVSVSLSASELDIPGLFLLHDFVNAKEEEDLLREVDARPWNNLAKRRVQHYGYE FCYQTRNVNTKHQLGELPPFVSHVVDRISLFPNTEDVADASLDQLTVNEYPPGVGLSPHIDTHSAFEGLIFSLSLAGPCI MEFRRYPEGAWHEFPLSIDLKMENSVNDSNYLRKAIYLPPRSMLLLSGEARYAWHHYIPHHKVRTDPCQCKFPHYCDSQR *
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: oxidoreductase activity, iron ion binding, Rho guanyl-nucleotide exchange factor activity, nucleic acid binding, nucleotide binding.
biological_process: oxidation-reduction process.

