Polypeptide MELO3C010584P1

Accession: MELO3C010584P1

Name: MELO3C010584P1

Description: Similar to Ribosome maturation protein SBDS (Mus musculus) (uniprot_sprot:sp|P70122|SBDS_MOUSE)

Sequence:

>MELO3C010584P1 Similar to Ribosome maturation protein SBDS (Mus musculus) (uniprot_sprot:sp|P70122|SBDS_MOUSE)
MSRSLVQPIGQKRLTNVAVVRLKKHGLRFEIACYKNKVLSWRSGVEKDLDEVLQSQIVYSNVSKGVLAKTKDLKAAFGTD
DQTEICLKILKEGELQVAGKEREAQLSNQFRDIATIVMQKTFNPETKRPYTISMIERLMREIHFAVDPNHSSKKQALEVI
HELQKQFPIKRSPMRLRYIVPEQNVPSLLDKLNAWSASIVSNDQSGNQQRSIICELDPSFYRDCNPLMSELHGRFEVLSF
CLHEEGDTNVDQYEDDYENVELLPRQLKETESSIPQLSEALQKQTISVNSDNAPKEGKRCSTCNVAVGDATKFREHHKSD
WHKHNVKRKTKNLPPLTEEECTVELAMGDSESDLKEYSF*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: ribosome maturation protein SDO1 (K14574).

COG: Predicted exosome subunit (COG1500).

These properties come from phylome analysis


molecular_function: ribosome binding, identical protein binding, RNA binding, rRNA binding, microtubule binding.

cellular_component: nucleus, cytoplasm, nucleolus, spindle pole.

biological_process: positive regulation of translation, ribosomal large subunit biogenesis, mature ribosome assembly, ribosome biogenesis, determination of adult lifespan, ribosomal subunit export from nucleus, bone marrow development, mitotic spindle stabilization, leukocyte chemotaxis, bone mineralization, learning, rRNA processing, regulation of transcription, DNA-dependent, inner cell mass cell proliferation.

These properties come from blast2go analysis


molecular_function: rRNA binding, zinc ion binding, microtubule binding.

cellular_component: cytoplasm, nucleolus, spindle pole.

biological_process: bone marrow development, mitotic spindle stabilization, leukocyte chemotaxis, bone mineralization, learning, rRNA processing, regulation of transcription, DNA-dependent, inner cell mass cell proliferation.

Locations

Located in CM3.5_scaffold01598 from 158768 to 161518.

This polypeptide in other databases

In PhylomeDB is Phy003A64J_CUCME .

Related features