Polypeptide MELO3C010635P1
Accession: MELO3C010635P1
Name: MELO3C010635P1
Description: Similar to Proteasome subunit beta type-3-B (Arabidopsis thaliana) (uniprot_sprot:sp|O81153|PSB3B_ARATH)
Sequence:
>MELO3C010635P1 Similar to Proteasome subunit beta type-3-B (Arabidopsis thaliana) (uniprot_sprot:sp|O81153|PSB3B_ARATH) MDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEPEELFETISQALLSSVDRDCLSGWGGHVYVVTPTEVKERILKGR MD*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: threonine-type endopeptidase activity.
cellular_component: cytoplasmic membrane-bounded vesicle, plasma membrane, proteasome core complex, nucleus.
biological_process: ubiquitin-dependent protein catabolic process.
These properties come from reactome analysis
REACTOME_COMPLEX: 26S proteasome [nucleoplasm] (REACT_7467), 26S proteasome [cytosol] (REACT_2353).
These properties come from phylome analysis
molecular_function: endopeptidase activator activity, protein binding, threonine-type endopeptidase activity.
cellular_component: proteasome storage granule, proteasome core complex, beta-subunit complex, endoplasmic reticulum membrane, cytoplasm, proteasome core complex, nucleus.
biological_process: proteolysis involved in cellular protein catabolic process, proteasomal ubiquitin-dependent protein catabolic process, locomotion, proteasomal ubiquitin-independent protein catabolic process, embryo development ending in birth or egg hatching, determination of adult lifespan, response to DNA damage stimulus, nematode larval development, reproduction.
These properties come from kegg analysis
COG: 20S proteasome, alpha and beta subunits (COG0638).
This polypeptide in other databases
In PhylomeDB is Phy003A4GV_CUCME .
