Polypeptide MELO3C010746P1

Accession: MELO3C010746P1

Name: MELO3C010746P1

Description: Similar to Graves disease carrier protein (Homo sapiens) (uniprot_sprot:sp|P16260|GDC_HUMAN)

Sequence:

>MELO3C010746P1 Similar to Graves disease carrier protein (Homo sapiens) (uniprot_sprot:sp|P16260|GDC_HUMAN)
MNPSQGSTLSANVAGFVDGSSAKREVSYIDSLPIYVKELIAGGAAGAFAKTAVAPLERIKILLQTRTEGFHSLGVFQSLK
KVLKHEGVRGFYKGNGASVVRIIPYAALHFMTYEQYRCWILDNYPGLGVGPHIDLLAGSVAGGTAVLCTYPLDLARTKLA
YQTTDTRTRNSGLRSYHTEPAYNGIKDVLVRVYRAGGARGLYRGVGPTLTGILPYAGLKFYVYEKLKSHVPEEHQSSIVM
RLSCGALAGLLGQTFTYPLDVVRRQMQVGDMPSSLNGQVRFRNSIEGLTMIVRNQGWRQLFAGLSINYIKIVPSVAIGFA
AYDSMKIWLRIPPRQKTQSISSAS*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: CoA transport across the inner mitochondrial membrane (REACT_105531), CoA transport across the inner mitochondrial membrane (REACT_11209).

biological_process: coenzyme biosynthetic process, pantothenate metabolic process, vitamin metabolic process, water-soluble vitamin metabolic process.

REACTOME_PATHWAY: Metabolism of water-soluble vitamins and cofactors (REACT_11238), Metabolism of vitamins and cofactors (REACT_101968), Coenzyme A biosynthesis (REACT_11218), Metabolism of water-soluble vitamins and cofactors (REACT_102551), Vitamin B5 (pantothenate) metabolism (REACT_30617), Coenzyme A biosynthesis (REACT_32705), Vitamin B5 (pantothenate) metabolism (REACT_11172), Metabolism of vitamins and cofactors (REACT_11193).

These properties come from phylome analysis


molecular_function: coenzyme A transmembrane transporter activity, binding, transporter activity.

cellular_component: integral to membrane, mitochondrial inner membrane.

biological_process: positive regulation of growth rate, embryo development ending in birth or egg hatching, transmembrane transport.

These properties come from blast2go analysis


molecular_function: binding, transporter activity.

cellular_component: integral to membrane, mitochondrial inner membrane.

biological_process: transmembrane transport, mitochondrial transport.

Locations

Located in CM3.5_scaffold00014 from 534586 to 537157.

This polypeptide in other databases

In PhylomeDB is Phy003ADH6_CUCME .

Related features