Polypeptide MELO3C010750P1

Accession: MELO3C010750P1

Name: MELO3C010750P1

Description: Similar to Mitochondrial substrate carrier family protein ancA (Dictyostelium discoideum) (uniprot_sprot:sp|O97470|ADT_DICDI)

Sequence:

>MELO3C010750P1 Similar to Mitochondrial substrate carrier family protein ancA (Dictyostelium discoideum) (uniprot_sprot:sp|O97470|ADT_DICDI)
MRVEDGDDLEMGDSRSIPVSPRAYKWLTNFHRDLLAGAFMGGLVHTIVAPIERAKLLLQTQESNLAIVGVGRRRFKGMFD
CIFRTVREEGILSLWRGNGSSVIRYYPSVALNFSLKDLYKEMLRNSFVDGHFLSGPSANFIAGAAAGCSTLILIYPLDIA
HTRLAADIGRTDVRQFRGICHFLSTIRKKDGIQGIYRGLPASLQGMVVHRGLYFGGFDTMKEILVEQSQSELALWKRWGV
AQVVTTSAGLLSYPFDTVRRRMMMQSGLDKPMYNGTLDCWRKIYRMEGVSSFYRGAVSNMFRSTGAAAILVLYDEVKKFM
KWGGL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: binding, transporter activity.

cellular_component: integral to membrane, mitochondrial inner membrane.

biological_process: transmembrane transport, mitochondrial transport.

These properties come from reactome analysis


REACTOME_REACTION: PB1-F2 binds to the mitochondrial adenine nucleotide translocator 3 ANT3, inducing apoptosis (REACT_6243), ADP-ATP translocase maintains a high ADP:ATP ratio in the matrix (REACT_9011), Association of Vpr with ANT1 (REACT_7958), ADP-ATP translocase maintains a high ADP:ATP ratio in the matrix (REACT_103683).

biological_process: viral reproduction, energy reserve metabolic process, viral infectious cycle, active induction of host immune response by virus, regulation of insulin secretion, virus-host interaction.

REACTOME_COMPLEX: PB1-F2: ANT 3 Complex [mitochondrial inner membrane] (REACT_6551), ANT1:Vpr complex [mitochondrial inner membrane] (REACT_8897), ADP/ATP translocase 1 homodimer [mitochondrial inner membrane] (REACT_3875), ADP/ATP translocase 2 homodimer [mitochondrial inner membrane] (REACT_2754), ADP/ATP translocase 3 homodimer [mitochondrial inner membrane] (REACT_3614).

REACTOME_PATHWAY: HIV Infection (REACT_6185), Diabetes pathways (REACT_106636), Integration of energy metabolism (REACT_1505), Host Interactions of HIV factors (REACT_6288), Influenza Infection (REACT_6167), Host Interactions with Influenza Factors (REACT_6323), Diabetes pathways (REACT_15380), Interactions of Vpr with host cellular proteins (REACT_6757), Regulation of Insulin Secretion (REACT_18325), Influenza Virus Induced Apoptosis (REACT_6213), Vpr-mediated induction of apoptosis by mitochondrial outer membrane permeabilization (REACT_8016), Regulation of Insulin Secretion (REACT_87602), Integration of energy metabolism (REACT_89538).

These properties come from phylome analysis


molecular_function: binding, transporter activity.

cellular_component: integral to membrane, mitochondrial inner membrane.

biological_process: transmembrane transport.

These properties come from kegg analysis


KEGG_ORTHOLOGS: solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31 (K05863).

molecular_function: adenine transmembrane transporter activity.

Locations

Located in CM3.5_scaffold00014 from 552503 to 554434.

This polypeptide in other databases

In PhylomeDB is Phy003AE6K_CUCME .

Related features