Polypeptide MELO3C010812P2

Accession: MELO3C010812P2

Name: MELO3C010812P2

Description: Similar to Adenine phosphoribosyltransferase 1, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|P31166|APT1_ARATH)

Sequence:

>MELO3C010812P2 Similar to Adenine phosphoribosyltransferase 1, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|P31166|APT1_ARATH)
MKAVFNLTSSLPLSPSPSHYYRTTAIFTPSPDLFASPSTAVGGAFSSCRTHLLTHFPQHPSSFSPLRCNVRKTVPDQEMA
STDKQDPRIPKISKAIRVIPDFPKPGILFQDITTLLLDTKAFKDTIDLFVERYRGKDISVVAGIEARGFIFGPPIALAIG
AKFVPMRKPKKLPGEVISEEYSLEYGTDKIEMHVGAVEAGERALVIDDLIATGGTLCAAISLLERVGVEVVECACVIELD
GLKGRERLGDKPLFVLVNAAG*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: adenine phosphoribosyltransferase activity.

cellular_component: chloroplast, plasma membrane.

biological_process: nucleoside metabolic process, adenine salvage.

These properties come from reactome analysis


REACTOME_REACTION: Adenine + PRPP => AMP + PPi (REACT_85316), Adenine + PRPP => AMP + PPi (REACT_90510), Adenine + PRPP => AMP + PPi (REACT_104879), Adenine + PRPP => AMP + PPi (REACT_165), Adenine + PRPP => AMP + PPi (REACT_31898), Adenine + PRPP => AMP + PPi (REACT_89305).

REACTOME_PATHWAY: Purine metabolism (REACT_90193), Purine metabolism (REACT_91779), Metabolism of nucleotides (REACT_28046), Purine salvage (REACT_31632), Purine salvage (REACT_78176), Purine metabolism (REACT_522), Metabolism of nucleotides (REACT_82673), Metabolism of nucleotides (REACT_86759), Metabolism of nucleotides (REACT_97332), Metabolism of nucleotides (REACT_29767), Purine metabolism (REACT_110082), Purine salvage (REACT_1923), Metabolism of nucleotides (REACT_1698), Purine salvage (REACT_108943), Purine salvage (REACT_109288), Purine salvage (REACT_99628), Purine metabolism (REACT_87509), Purine metabolism (REACT_87690).

REACTOME_COMPLEX: APRT homodimer [cytosol] (REACT_2360).

biological_process: nucleobase, nucleoside and nucleotide metabolic process, purine base metabolic process, purine-containing compound salvage.

These properties come from phylome analysis


molecular_function: adenine phosphoribosyltransferase activity.

cellular_component: plant-type cell wall, cytosol, cytoplasm, chloroplast, plasma membrane.

biological_process: response to cadmium ion, purine ribonucleoside salvage, nucleoside metabolic process, adenine salvage.

These properties come from kegg analysis


KEGG_REACTION: 1-(5'-Phosphoribosyl)-5-amino-4-imidazolecarboxamide:pyrophosphate (R04378), GMP:diphosphate (R01229), AMP:diphosphate (R00190).

molecular_function: adenine phosphoribosyltransferase activity.

COG: Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins (COG0503).

Locations

Located in CM3.5_scaffold00014 from 1000345 to 1003199.

This polypeptide in other databases

In PhylomeDB is Phy003AE8Y_CUCME .

Related features