Polypeptide MELO3C010882P2

Accession: MELO3C010882P2

Name: MELO3C010882P2

Description: Similar to Origin recognition complex subunit 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q38899|ORC2_ARATH)

Sequence:

>MELO3C010882P2 Similar to Origin recognition complex subunit 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q38899|ORC2_ARATH)
MEIDDLDDEEFAFSRNYFLAKELGGSKKKSSGKLADIDVVDEQELRAAAANIEPKHESEIAALMSSYESSYSKWVFELRC
GFGLLMYGFGSKKSLIEDFASRALVDYSVIVVNGYLQSVNIKQVIVAIAEELSDQLKSRPKNASGSNAHQTFSSRSMDDL
FVFLNGSNEEDKDCFVCVVIHNIDGPGLRDSETQEYLARVAACSHVRIIASVDHVNAPLLWDKKMVHTQFNWLWYHVPTF
APYKIEGMFFPLILAHGGTAQSAKTATIVLQSLTPNAQSVFKVLIEHQLSHPDEEGMPIDKLYATCRERFLVSSQITLNS
HLTEFKDHELVKIRRHSDGQDCLYIPLPSEALEKLLTELS*

Download fasta sequence.

Properties

These properties come from reactome analysis

REACTOME_REACTION: Orc3 associates with Orc2 constitutively bound at origins of replication (REACT_83258), CDC6 association with ORC:origin complexes mediated by MCM8 (REACT_109935), Orc4 associates with Orc5:Orc3:Orc2:origin complexes (REACT_34401), Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_85587), Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_541), Free CDT1 associates with CDC6:ORC:origin complexes (REACT_1975), Orc1 associates with Orc4:Orc5:Orc3:Orc2:origin complexes (REACT_664), Cdt1 is displaced from the pre-replicative complex. (REACT_951), Orc4 associates with Orc5:Orc3:Orc2:origin complexes (REACT_30500), Orc1 associates with Orc4:Orc5:Orc3:Orc2:origin complexes (REACT_29937), DNA Replication Factor A (RPA) associates with the pre-replicative complex at the origin (REACT_789), CDC6 association with ORC:origin complexes mediated by MCM8 (REACT_85156), Cdc45 associates with the pre-replicative complex at the origin (REACT_135), CDC6 association with ORC:origin complexes mediated by MCM8 (REACT_282), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_32416), Orc3 associates with Orc2 constitutively bound at origins of replication (REACT_533), Association of MCM8 with ORC:origin complex (REACT_105912), Orc6 associates with Orc1:Orc4:Orc5:Orc3:Orc2:origin complexes, forming ORC:origin complexes (REACT_984), Association of MCM8 with ORC:origin complex (REACT_6731), Orc5 associates with Orc3:Orc2:origin complexes (REACT_88517), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_106952), Association of Cyclin B/Cdk1 with replicative origin inhibits pre-RC formation (REACT_86406), Cdc45 associates with the pre-replicative complex at the origin (REACT_83433), Loading of claspin onto DNA during replication origin firing (REACT_6738), Orc6 associates with Orc1:Orc4:Orc5:Orc3:Orc2:origin complexes, forming ORC:origin complexes (REACT_79929), Orc3 associates with Orc2 constitutively bound at origins of replication (REACT_80130), Orc5 associates with Orc3:Orc2:origin complexes (REACT_103863), Activation of claspin (REACT_6750), Association of MCM8 with ORC:origin complex (REACT_96893), Orc5 associates with Orc3:Orc2:origin complexes (REACT_88363), Cdc45 associates with the pre-replicative complex at the origin (REACT_31079), Orc6 associates with Orc1:Orc4:Orc5:Orc3:Orc2:origin complexes, forming ORC:origin complexes (REACT_29566), Cdt1 is displaced from the pre-replicative complex. (REACT_84780), Association of Cyclin B/Cdk1 with replicative origin inhibits pre-RC formation (REACT_555), Orc1 is phosphorylated by cyclin A/CDK2 (REACT_2111), Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_76949), Cdc45 associates with the pre-replicative complex at the origin (REACT_108604), Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_98657), Orc1 is phosphorylated by cyclin A/CDK2 (REACT_81715), Orc1 associates with Orc4:Orc5:Orc3:Orc2:origin complexes (REACT_33371), Orc1 associates with Orc4:Orc5:Orc3:Orc2:origin complexes (REACT_78929), Free CDT1 associates with CDC6:ORC:origin complexes (REACT_77472), Orc4 associates with Orc5:Orc3:Orc2:origin complexes (REACT_1295), Orc5 associates with Orc3:Orc2:origin complexes (REACT_146), CDK and DDK associate with the Mcm10:pre-replicative complex (REACT_2227), Orc4 associates with Orc5:Orc3:Orc2:origin complexes (REACT_84030), Orc3 associates with Orc2 constitutively bound at origins of replication (REACT_29117), CDC6 association with ORC:origin complexes mediated by MCM8 (REACT_79561), DNA Replication Factor A (RPA) associates with the pre-replicative complex at the origin (REACT_95886), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_1770), Loading of claspin onto DNA during replication origin firing (REACT_89725), Orc6 associates with Orc1:Orc4:Orc5:Orc3:Orc2:origin complexes, forming ORC:origin complexes (REACT_106513), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_96094).

biological_process: mitotic cell cycle, DNA replication, M/G1 transition of mitotic cell cycle, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, cell cycle checkpoint.

REACTOME_COMPLEX: Mcm10:pre-replicative complex [nucleoplasm] (REACT_5685), pre-replicative complex [nucleoplasm] (REACT_4388), Orc3:Orc2:origin [nucleoplasm] (REACT_5183), CDT1:CDC6:ORC:origin complex [nucleoplasm] (REACT_5333), Cdc45:CDK:DDK:Mcm10:pre-replicative complex [nucleoplasm] (REACT_4546), CDK:DDK:Mcm10:pre-replicative complex [nucleoplasm] (REACT_2458), ORC:origin:cyclin B:cdk1 complex [nucleoplasm] (REACT_4235), Cdc45:CDK:DDK:Mcm10:Activated claspin:pre-replicative complex [nucleoplasm] (REACT_7262), Orc4:Orc5:Orc3:Orc2:origin [nucleoplasm] (REACT_4462), RPA:Cdc45:CDK:DDK:Mcm10:pre-replicative complex [nucleoplasm] (REACT_2568), Orc2:origin [nucleoplasm] (REACT_4170), ORC complex bound to origin [nucleoplasm] (REACT_7859), CDC6:ORC:origin complex [nucleoplasm] (REACT_4079), ORC:origin [nucleoplasm] (REACT_3844), Mcm10:active pre-replicative complex [nucleoplasm] (REACT_2683), active pre-replicative complex [nucleoplasm] (REACT_5627), Orc2 associated with MCM8 [nucleoplasm] (REACT_7878), Orc5:Orc3:Orc2:origin [nucleoplasm] (REACT_2818), Cdc45:CDK:DDK:Mcm10:claspin:pre-replicative complex [nucleoplasm] (REACT_7273), pre-replicative complex (Orc1-minus) [nucleoplasm] (REACT_3695), Orc1:Orc4:Orc5:Orc3:Orc2:origin [nucleoplasm] (REACT_2696).

REACTOME_PATHWAY: Orc1 removal from chromatin (REACT_105679), Cell Cycle Checkpoints (REACT_1538), M/G1 Transition (REACT_79481), Assembly of the ORC complex at the origin of replication (REACT_567), Association of licensing factors with the pre-replicative complex (REACT_77177), Assembly of the ORC complex at the origin of replication (REACT_77918), Activation of the pre-replicative complex (REACT_89455), Switching of origins to a post-replicative state (REACT_2148), DNA Replication (REACT_383), Switching of origins to a post-replicative state (REACT_83310), Cell Cycle, Mitotic (REACT_96281), Mitotic M-M/G1 phases (REACT_82114), Activation of the pre-replicative complex (REACT_1095), Assembly of the ORC complex at the origin of replication (REACT_87008), Removal of licensing factors from origins (REACT_98372), Orc1 removal from chromatin (REACT_1156), Activation of the pre-replicative complex (REACT_110126), Mitotic G1-G1/S phases (REACT_21267), Activation of ATR in response to replication stress (REACT_108929), E2F mediated regulation of DNA replication (REACT_79760), Cell Cycle, Mitotic (REACT_152), G1/S Transition (REACT_1783), Removal of licensing factors from origins (REACT_207), G2/M Checkpoints (REACT_86653), Mitotic M-M/G1 phases (REACT_21300), CDC6 association with the ORC:origin complex (REACT_100415), Mitotic M-M/G1 phases (REACT_95347), Association of licensing factors with the pre-replicative complex (REACT_108717), Association of licensing factors with the pre-replicative complex (REACT_29802), DNA Replication Pre-Initiation (REACT_99126), M/G1 Transition (REACT_32146), Cell Cycle, Mitotic (REACT_85950), Association of licensing factors with the pre-replicative complex (REACT_1181), CDC6 association with the ORC:origin complex (REACT_31806), Activation of the pre-replicative complex (REACT_83196), Assembly of the pre-replicative complex (REACT_94473), DNA Replication Pre-Initiation (REACT_88865), Regulation of DNA replication (REACT_829), G2/M Checkpoints (REACT_828), Mitotic G1-G1/S phases (REACT_93079), Regulation of DNA replication (REACT_101505), E2F-enabled inhibition of pre-replication complex formation (REACT_100176), Synthesis of DNA (REACT_31294), DNA Replication Pre-Initiation (REACT_734), Mitotic M-M/G1 phases (REACT_88420), Synthesis of DNA (REACT_2014), Mitotic G1-G1/S phases (REACT_82281), S Phase (REACT_89318), G1/S Transition (REACT_102687), CDC6 association with the ORC:origin complex (REACT_1707), M/G1 Transition (REACT_83776), CDT1 association with the CDC6:ORC:origin complex (REACT_1949), Regulation of DNA replication (REACT_109529), G1/S Transition (REACT_109784), CDC6 association with the ORC:origin complex (REACT_110064), M/G1 Transition (REACT_1725), DNA Replication (REACT_106731), Assembly of the pre-replicative complex (REACT_108945), Assembly of the ORC complex at the origin of replication (REACT_86555), Regulation of DNA replication (REACT_102039), S Phase (REACT_899), DNA Replication (REACT_85544), Cell Cycle Checkpoints (REACT_109101), Assembly of the pre-replicative complex (REACT_2243), DNA Replication (REACT_102375), Cell Cycle, Mitotic (REACT_90846), E2F mediated regulation of DNA replication (REACT_471), DNA Replication Pre-Initiation (REACT_32026), Assembly of the pre-replicative complex (REACT_88527), G1/S Transition (REACT_87037), CDT1 association with the CDC6:ORC:origin complex (REACT_108833), E2F-enabled inhibition of pre-replication complex formation (REACT_1321), Activation of ATR in response to replication stress (REACT_6769), Mitotic G1-G1/S phases (REACT_109527).

These properties come from phylome analysis

molecular_function: protein binding, chromatin binding, identical protein binding, DNA replication origin binding.

cellular_component: DNA replication preinitiation complex, nucleoplasm, nucleus, origin recognition complex, chromosome, centromeric region, nuclear chromosome, nuclear origin of replication recognition complex.

biological_process: histone H3-K4 methylation, hermaphrodite genitalia development, negative regulation of vulval development, positive regulation of multicellular organism growth, positive regulation of locomotion, locomotion, positive regulation of growth rate, body morphogenesis, embryo development ending in birth or egg hatching, cell proliferation, eggshell chorion gene amplification, mitotic chromosome condensation, mitotic spindle organization, chromatin silencing at telomere, DNA replication, M/G1 transition of mitotic cell cycle, negative regulation of transcription from RNA polymerase II promoter, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, cell cycle checkpoint, chromatin silencing at silent mating-type cassette, DNA-dependent DNA replication initiation, pre-replicative complex assembly.

These properties come from blast2go analysis

molecular_function: identical protein binding, DNA replication origin binding.

cellular_component: nuclear origin of replication recognition complex, pre-replicative complex.

biological_process: chromatin silencing at silent mating-type cassette, DNA-dependent DNA replication initiation, pre-replicative complex assembly.

Locations

Located in CM3.5_scaffold00014 from 1429232 to 1431304.

This polypeptide in other databases

In PhylomeDB is Phy003A3V9_CUCME .

Related features