Polypeptide MELO3C010935P1

Accession: MELO3C010935P1

Name: MELO3C010935P1

Description: Similar to Deoxyuridine 5'-triphosphate nucleotidohydrolase (Solanum lycopersicum PE=2 SV=1) (uniprot_sprot:sp|P32518|DUT_SOLLC)

Sequence:

>MELO3C010935P1 Similar to Deoxyuridine 5'-triphosphate nucleotidohydrolase (Solanum lycopersicum PE=2 SV=1) (uniprot_sprot:sp|P32518|DUT_SOLLC)
MFGLAGSKALKTGVLGSATDFVQTGPCARRSRRKMAGNIGAIVDNGAFLSRLPRYKPHLSSSNSKSNRINFRFNSYFSQT
LKMAQNGTSEVQESLRSPKVQKLTHDNGESENVSKSSMLLRVKKLSEKAVLPSRASALSAGYDLSSAVETKVPARGKVLV
PTDLSIAIPEGTYARIAPRSGLALKHAIDVGAGVIDADYRGPVGVILFNHSDVDFEVKAGDRIAQMILEKIVTPEVMEVE
DLDSTLRGEGGFGSTGV*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: dUTP diphosphatase activity, magnesium ion binding.

biological_process: dUTP metabolic process.

These properties come from reactome analysis

REACTOME_REACTION: dUTP + H2O => dUMP + pyrophosphate (REACT_81301), dUTP + H2O => dUMP + pyrophosphate (REACT_150), dUTP + H2O => dUMP + pyrophosphate (REACT_92619), dUTP + H2O => dUMP + pyrophosphate (REACT_103311), dUTP + H2O => dUMP + pyrophosphate (REACT_106534), dUTP + H2O => dUMP + pyrophosphate (REACT_96660).

REACTOME_PATHWAY: Pyrimidine biosynthesis (REACT_79272), Pyrimidine metabolism (REACT_87817), Pyrimidine biosynthesis (REACT_99653), Metabolism of nucleotides (REACT_28046), Pyrimidine metabolism (REACT_957), Pyrimidine biosynthesis (REACT_21376), Pyrimidine biosynthesis (REACT_105473), Metabolism of nucleotides (REACT_82673), Metabolism of nucleotides (REACT_86759), Metabolism of nucleotides (REACT_97332), Metabolism of nucleotides (REACT_29767), Pyrimidine biosynthesis (REACT_86260), Pyrimidine metabolism (REACT_32589), Pyrimidine metabolism (REACT_30021), Metabolism of nucleotides (REACT_1698), Pyrimidine metabolism (REACT_86085), Pyrimidine metabolism (REACT_90567), Pyrimidine biosynthesis (REACT_82063).

REACTOME_COMPLEX: DUT trimer [nucleoplasm] (REACT_21950).

biological_process: nucleobase, nucleoside and nucleotide metabolic process, pyrimidine nucleoside biosynthetic process, pyrimidine base metabolic process.

These properties come from phylome analysis

molecular_function: metal ion binding, identical protein binding, protein binding, dUTP diphosphatase activity, magnesium ion binding.

cellular_component: mitochondrion, cytoplasm, nucleoplasm, nucleus.

biological_process: pyrimidine nucleoside biosynthetic process, embryo development ending in birth or egg hatching, pyrimidine deoxyribonucleoside triphosphate catabolic process, DNA repair, DNA replication, pyrimidine base metabolic process, cytokinesis, reproduction, dUTP metabolic process.

These properties come from kegg analysis

KEGG_REACTION: dUTP (R02100).

KEGG_ORTHOLOGS: dUTP pyrophosphatase [EC:3.6.1.23] (K01520).

molecular_function: dUTP diphosphatase activity.

COG: dUTPase (COG0756).

Locations

Located in CM3.5_scaffold00014 from 1722435 to 1723374.

This polypeptide in other databases

In PhylomeDB is Phy003A1WR_CUCME .

Related features