Polypeptide MELO3C010966P1
Accession: MELO3C010966P1
Name: MELO3C010966P1
Description: Similar to Mitogen-activated protein kinase homolog NTF3 (Nicotiana tabacum) (uniprot_sprot:sp|Q40517|NTF3_TOBAC)
Sequence:
>MELO3C010966P1 Similar to Mitogen-activated protein kinase homolog NTF3 (Nicotiana tabacum) (uniprot_sprot:sp|Q40517|NTF3_TOBAC) MATPVEPPNGVRSQGKHYYSMWQTLFEIDTKYIPIKPIGRGAYGIVCSSVNRETNEKVAIKRIHNAFENRIDALRTLREL KLLRHLRHENVICLKDVMMPIHRRSFKDVYLVYELMDTDLHQIIKSSQTLTNDHCQYFLFQLLRGLKYLHSANILHRDLK PGNLLVNANCDLKICDFGLARTSNGKNQFMTEYVVTRWYRAPELLLCCENYGTSIDVWSVGCIFAELLGRKPIFPGTECL NQLKLIINLLGSQREEDLEFIDNPKARRYIKSLPYSPGAPLSRLYPNAHPLAIDLLQKMLVFDPSKRISVTEALQHPYMS PLYDPNSNPPAQVPIDLEIDEELGEEMIREMMWKEMLHYHPEDLEEHSEMTRFHPEPTTSSTAVYS*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP binding, protein binding, MAP kinase activity.
biological_process: protein phosphorylation.
These properties come from reactome analysis
REACTOME_REACTION: MAP kinase activates MAPKAPK2, MAPKAPK3 and MSK1 (REACT_85146), ERKs are inactivated by protein phosphatase 2A (REACT_12539), Nuclear translocation of phospho-ERK-2 dimer (REACT_487), ERKs are inactivated by dual-specific phosphatases (DUSPs) (REACT_12439), Interaction of p38 MAPK with JLP (REACT_21282), ERK1/2 phosphorylates MSK1 (REACT_12576), Nuclear translocation of phospho-ERK-1 dimer (REACT_1866), MEK1 phosphorylates ERK-1 (REACT_136), Active p38 MAPK phosphorylates MAPKAPK2 or 3 (REACT_21375), Dimerisation of phospho-ERK-2 (REACT_2196), Phosphorylated MAPKs phosphorylate ATF-2 (REACT_6719), Phosphorylation of L1 by ERK (REACT_22099), ERK1/2/5 activate RSK1/2/3 (REACT_12487), Active p38 MAPK phosphorylates MAPKAPK2 or 3 (REACT_28738), MEK1 binds ERK-1 (REACT_1780), p38MAPK phosphorylates MSK1 (REACT_105534), Dimerisation of phospho-ERK-1 (REACT_1289), Activation of p38 MAPK (REACT_75807), Phosphorylation of E proteins by p38 MAPK (REACT_21321), Nuclear export of human p38 MAPK mediated by its substrate MAPKAPK2 or 3 (REACT_95261), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_91195), MEK2 binds ERK-2 (REACT_495), p38MAPK phosphorylates MSK1 (REACT_12546), Phosphorylation of KSRP by MAP kinase p38 (REACT_24965), ERK1/2 activates ELK1 (REACT_12406), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_21395), Phosphorylation of cPLA2 by ERK-2 (REACT_23990), SOS phosphorylation and dissociation (IRS) (REACT_169), Beta-arrestin-1 acts as scaffold for a PAR1 signalling complex (REACT_23781), Dissociation of phospho-ERK-1:MEK1 (REACT_1740), MEK2 phosphorylates ERK-2 (REACT_2247), MAP kinase activates MAPKAPK2, MAPKAPK3 and MSK1 (REACT_12032), Dissociation of phospho-ERK-2:MEK2 (REACT_1019), Phosphorylation of MEF2 proteins by p38 (REACT_21276), Phosphorylation by MAPK/ERK (REACT_20562), c-FOS activation by phospho ERK1/2 (REACT_21251), Phosphorylation of cPLA2 by MAPK p38 alpha (REACT_20541), Nuclear export of human p38 MAPK mediated by its substrate MAPKAPK2 or 3 (REACT_21358), Phosphorylation of UBF-1:rDNA Promoter (REACT_180), SOS phosphorylation and dissociation (SHC) (REACT_1420), AGER binds ERK1/2 (REACT_25020), SOS phosphorylation and dissociation (IRS, Crk) (REACT_26), Activation of MAPK (REACT_20631), Beta-arrestin-2 acts as scaffold for a PAR1 signalling complex (REACT_23960).
biological_process: small GTPase mediated signal transduction, Ras protein signal transduction, stress-activated MAPK cascade, innate immune response, mRNA metabolic process, toll-like receptor signaling pathway, axon guidance, synaptic transmission, MAPKKK cascade, MyD88-independent toll-like receptor signaling pathway, MyD88-dependent toll-like receptor signaling pathway, RNA metabolic process, nerve growth factor receptor signaling pathway, toll-like receptor 4 signaling pathway, insulin receptor signaling pathway, transcription from RNA polymerase I promoter, transcription initiation from RNA polymerase I promoter, muscle cell differentiation, nucleotide-binding oligomerization domain containing signaling pathway, platelet activation, epidermal growth factor receptor signaling pathway, Toll signaling pathway, blood coagulation, activation of innate immune response, positive regulation of muscle cell differentiation, toll-like receptor 1 signaling pathway, toll-like receptor 2 signaling pathway, toll-like receptor 3 signaling pathway, activation of MAPKK activity, activation of MAPK activity, ERK1 and ERK2 cascade, regulation of sequence-specific DNA binding transcription factor activity.
REACTOME_COMPLEX: phospho-ERK-2 dimer [nucleoplasm] (REACT_5046), p38 MAPK : MAPKAPK2 or MAPKAPK3 [nucleoplasm] (REACT_22059), phospho-ERK-2:MEK2 [cytosol] (REACT_3199), MAP kinase p38 (Mg2+ cofactor) [cytosol] (REACT_12099), phospho p38:phospho MEF2 [nucleoplasm] (REACT_21504), AGER ligands:AGER:ERK [plasma membrane] (REACT_26296), p38 alpha/beta/gamma:ABL1:JLP:CDO complex [plasma membrane] (REACT_21610), pL1 (S1204, 1248):ERK2:clathrin-dynamin complex [endosome] (REACT_23286), pp38 alpha/beta/gamma:ABL1:JLP:CDO complex [plasma membrane] (REACT_21750), MEK2:ERK-2 [cytosol] (REACT_5435), Activated PAR1:Beta-arrestin-1:Activated Src:ERK [plasma membrane] (REACT_24357), Activated PAR1:Beta-arrestin-1:Src:ERK [plasma membrane] (REACT_24135), phospho-p38 MAPK : phospho MAPKAPK2 or phospho MaPKAPK3 [cytosol] (REACT_21519), phospho-p38 MAPK : MAPKAPK2 or MaPKAPK3 [nucleoplasm] (REACT_21530), phospho-p38 MAPK : phospho MAPKAPK2 or phospho MaPKAPK3 [nucleoplasm] (REACT_21539), Activated PAR1:Beta-arrestin-2:Src:ERK [plasma membrane] (REACT_24842), phospho-ERK-2 dimer [cytosol] (REACT_3688), phospho-ERK-1 dimer [cytosol] (REACT_3932), phospho-ERK-1 dimer [nucleoplasm] (REACT_3152), Phospho-MAP kinase p38 (Mg2+ cofactor) [cytosol] (REACT_12273), Activated PAR1:Beta-arrestin-1:Activated Src:Activated ERK [plasma membrane] (REACT_24392), MEK1:ERK-1 [cytosol] (REACT_5539), phospho-ERK-1:MEK1 [cytosol] (REACT_2796).
REACTOME_PATHWAY: Toll Like Receptor 4 (TLR4) Cascade (REACT_109895), ADP signalling through P2Y purinoceptor 1 (REACT_19140), Thrombin signalling through proteinase activated receptors (PARs) (REACT_21384), Prolonged ERK activation events (REACT_12005), Regulation of mRNA Stability by Proteins that Bind AU-rich Elements (REACT_24994), SHC-mediated signalling (REACT_661), ERK/MAPK targets (REACT_31447), ERK activation (REACT_1482), ERK/MAPK targets (REACT_12599), MAP kinase activation in TLR cascade (REACT_82500), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_95028), G-protein mediated events (REACT_15526), Down-stream signal transduction (REACT_17025), MAP kinase activation in TLR cascade (REACT_21308), Toll Like Receptor 9 (TLR9) Cascade (REACT_9047), MyD88:Mal cascade initiated on plasma membrane (REACT_92018), NCAM signaling for neurite out-growth (REACT_18334), MyD88 dependent cascade initiated on endosome (REACT_25222), Toll Like Receptor TLR6:TLR2 Cascade (REACT_106218), activated TAK1 mediates p38 MAPK activation (REACT_21399), Grb2 events in EGFR signaling (REACT_12606), RNA Polymerase I Promoter Opening (REACT_2232), Signaling by PDGF (REACT_16888), Toll Like Receptor 2 Cascade (REACT_109018), Platelet homeostasis (REACT_23876), Toll Receptor Cascades (REACT_91529), Activation of the AP-1 family of transcription factors (REACT_21326), Signaling by Insulin receptor (REACT_498), p38MAPK events (REACT_33936), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_21328), Platelet sensitization by LDL (REACT_23879), ERK2 activation (REACT_1183), MyD88 cascade initiated on plasma membrane (REACT_27215), Immune System (REACT_6900), Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways (REACT_75913), CDO in myogenesis (REACT_21402), Signalling to RAS (REACT_12033), Signalling to RAS (REACT_79426), Toll Like Receptor 5 (TLR5) Cascade (REACT_30810), Signalling by NGF (REACT_11061), Insulin receptor signalling cascade (REACT_1195), Platelet activation triggers (REACT_622), Toll Like Receptor 9 (TLR9) Cascade (REACT_32391), Myogenesis (REACT_21303), Post NMDA receptor activation events (REACT_20593), Signal attenuation (REACT_508), activated TAK1 mediates p38 MAPK activation (REACT_87442), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91838), Advanced glycosylation endproduct receptor signaling (REACT_25195), Opioid Signalling (REACT_15295), RSK activation (REACT_20510), Metabolism of mRNA (REACT_20605), Toll Like Receptor TLR6:TLR2 Cascade (REACT_8006), Toll Like Receptor TLR1:TLR2 Cascade (REACT_8005), Signal transduction by L1 (REACT_22272), NOD1/2 Signaling Pathway (REACT_75776), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_34578), Toll Like Receptor 4 (TLR4) Cascade (REACT_6894), Signalling to ERKs (REACT_32318), Signalling by NGF (REACT_97378), RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription (REACT_21352), MyD88 cascade initiated on plasma membrane (REACT_81183), Toll Like Receptor 3 (TLR3) Cascade (REACT_99649), IRS-mediated signalling (REACT_332), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_25024), Nuclear Events (kinase and transcription factor activation) (REACT_90219), Immune System (REACT_105951), Formation of Platelet plug (REACT_20), Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_15370), Recycling pathway of L1 (REACT_22365), Axon guidance (REACT_18266), SOS-mediated signalling (REACT_524), RNA Polymerase I Promoter Clearance (REACT_1974), MyD88 dependent cascade initiated on endosome (REACT_87458), PLC beta mediated events (REACT_15426), Signalling to p38 via RIT and RIN (REACT_12077), Frs2-mediated activation (REACT_12076), Synaptic Transmission (REACT_13685), Shc events in EGFR signaling (REACT_12579), Transcription (REACT_1788), Signaling by EGFR (REACT_9417), ARMS-mediated activation (REACT_12002), L1CAM interactions (REACT_22205), RAF/MAP kinase cascade (REACT_634), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_9020), Toll Like Receptor 10 (TLR10) Cascade (REACT_9027), Transmission across Chemical Synapses (REACT_13477), RNA Polymerase I Transcription (REACT_1309), Toll Like Receptor 3 (TLR3) Cascade (REACT_6783), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_6782), Innate Immunity Signaling (REACT_88681), Toll Like Receptor 2 Cascade (REACT_7980), Toll Receptor Cascades (REACT_6966), MyD88:Mal cascade initiated on plasma membrane (REACT_6788), Platelet Activation (REACT_798), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_78994), Activated TLR4 signalling (REACT_6890), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_34570), p38MAPK events (REACT_12065), SHC-related events (REACT_999), MyD88-independent cascade initiated on plasma membrane (REACT_6809), Destabilization of mRNA by KSRP (REACT_25042), Activation of NMDA receptor upon glutamate binding and postsynaptic events (REACT_20563), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_25281), CREB phosphorylation through the activation of Ras (REACT_20568), Innate Immunity Signaling (REACT_6802), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79068), Signal amplification (REACT_20524), ERK1 activation (REACT_1391), Activated TLR4 signalling (REACT_90914), NGF signalling via TRKA from the plasma membrane (REACT_29880), Ca-dependent events (REACT_15307), NGF signalling via TRKA from the plasma membrane (REACT_12056), MyD88-independent cascade initiated on plasma membrane (REACT_99643), Signalling to ERKs (REACT_12058), Toll Like Receptor 10 (TLR10) Cascade (REACT_92313), Nuclear Events (kinase and transcription factor activation) (REACT_12433), ERKs are inactivated (REACT_12436), Toll Like Receptor 5 (TLR5) Cascade (REACT_9061), Hemostasis (REACT_604), IRS-related events (REACT_762), phospho-PLA2 pathway (REACT_15466), Metabolism of RNA (REACT_21257).
These properties come from kegg analysis
molecular_function: MAP kinase activity.
This polypeptide in other databases
In PhylomeDB is Phy003A7BH_CUCME .
