Polypeptide MELO3C011003P1

Accession: MELO3C011003P1

Name: MELO3C011003P1

Description: Similar to Transcription factor E2FC (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FV70|E2FC_ARATH)

Sequence:

>MELO3C011003P1 Similar to Transcription factor E2FC (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FV70|E2FC_ARATH)
MRSNDSSCEPVSSANEKQNKKFKLQKNSKSKTQKSVDEPVDSPNPSTNGRYDSSLGFLTKKFISLVQEAEDGTLDLNKTA
DVLKVQKRRIYDITNVLEGIGLIEKTTTNHIRWKGGERRGPQELNDQVGRLKDEVKSLYADERKLDELIRNKNF*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein binding, sequence-specific DNA binding transcription factor activity.

cellular_component: transcription factor complex.

biological_process: regulation of transcription, DNA-dependent.

These properties come from phylome analysis


molecular_function: protein heterodimerization activity, DNA binding, sequence-specific DNA binding transcription factor activity.

cellular_component: cytoplasm, nucleolus, transcription factor complex.

biological_process: negative regulation of cell division, cell division, DNA endoreduplication, transcription, DNA-dependent, cell morphogenesis, regulation of transcription, DNA-dependent.

Locations

Located in CM3.5_scaffold00014 from 2247372 to 2249553.

This polypeptide in other databases

In PhylomeDB is Phy003MFQP_CUCME .

Related features