Polypeptide MELO3C011020P1

Accession: MELO3C011020P1

Name: MELO3C011020P1

Description: Similar to Kinesin-like protein KIF22 (Mus musculus) (uniprot_sprot:sp|Q3V300|KIF22_MOUSE)

Sequence:

>MELO3C011020P1 Similar to Kinesin-like protein KIF22 (Mus musculus) (uniprot_sprot:sp|Q3V300|KIF22_MOUSE)
MEDGSPVQCPNTVTVRRNPHRRARATPAAKAAESNLTSAISSFPLQEILAMDVPQNPKDNSSASSSVQTSLSENLKVYLR
VRPLQLKNLKKSGNPGDQNSSRSGHVWPQNPQKKKAAKEKNVKKKSNEACITINDDHSVTVCPPMALQETRRSKSEVYEG
FSHVFSMESSQDEVYERMVSPLVEDFLKGKSGMLTALGPSGSGKTHTIFGSPRVPGMVPLALQHIFRTESSDSKTSRSYY
LSIFEIYSEKGKGEKMYDLSADGGELTMQQFTIKGLKEVLISKAGEAESLVACAMTKRATAITNANSTSSRSQCIINVRR
VANQDEVEDASNCAILTIADLAGAEKEKRTGNQVLYSFGVWI*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Regulation of MKLP-1 by phosphorylation (REACT_110947).

biological_process: M phase of mitotic cell cycle, mitotic cell cycle, cytokinesis.

REACTOME_PATHWAY: Mitotic Telophase /Cytokinesis (REACT_94382), Cell Cycle, Mitotic (REACT_96281), Mitotic M-M/G1 phases (REACT_95347), M Phase (REACT_93720), DNA Replication (REACT_106731).

These properties come from phylome analysis


molecular_function: ATP binding, protein binding, microtubule motor activity.

cellular_component: midbody, microtubule, spindle, centrosome, nucleus.

biological_process: positive regulation of NFAT protein import into nucleus, maintenance of protein location in cell, regulation of Wnt receptor signaling pathway, female meiosis chromosome segregation, peripheral nervous system development, smoothened signaling pathway, mitotic spindle organization, microtubule-based movement, cell fate determination, contractile ring contraction involved in cell cycle cytokinesis, cytokinesis, actomyosin contractile ring assembly.

These properties come from blast2go analysis


molecular_function: motor activity, nucleotide binding.

cellular_component: cytoskeletal part, microtubule cytoskeleton.

biological_process: cellular process.

Locations

Located in CM3.5_scaffold00014 from 2350798 to 2353373.

This polypeptide in other databases

In PhylomeDB is Phy003MJ08_CUCME .

Related features