Polypeptide MELO3C011321P1
Accession: MELO3C011321P1
Name: MELO3C011321P1
Description: Similar to Transcription initiation factor TFIID subunit 10 (Mus musculus) (uniprot_sprot:sp|Q8K0H5|TAF10_MOUSE)
Sequence:
>MELO3C011321P1 Similar to Transcription initiation factor TFIID subunit 10 (Mus musculus) (uniprot_sprot:sp|Q8K0H5|TAF10_MOUSE) MNHSQQATGSRHDDDAALSEFLASLMEYTPTIPDELVEHYLGKSGFQCPDVRLIRLVAVATQKFVADVASDALQHCKARQ AAVVKDKRDKQQKDKRLILTMEDLSKALREGIVNVHAFSFYDHHFGNDYVLSIDTW*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_103685), HIV-1 Promoter Opening: First Transition (REACT_6134), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), Abortive initiation after formation of the first phosphodiester bond (REACT_32630), Fall Back to Closed Pre-initiation Complex (REACT_6211), Recognition and Binding of Core Promoter Elements by TFIID (REACT_745), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Formation of the closed pre-initiation complex (REACT_98407), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_100344), Formation of the closed pre-initiation complex (REACT_83351), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Fall Back to Closed Pre-initiation Complex (REACT_86577), Binding of TFIIE to the growing preinitiation complex (REACT_78942), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_99814), Binding of TFIIA and TFIIB to the pol II promoter:TFIID complex (REACT_266), NTP Binds Active Site of RNA Polymerase II (REACT_84849), Abortive Initiation Before Second Transition (REACT_543), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28192), Binding of TFIIE to the growing preinitiation complex (REACT_32367), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86674), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28433), Abortive Initiation Before Second Transition (REACT_106763), Binding of TFIIA and TFIIB to the pol II promoter:TFIID complex (REACT_92302), NTP Binds Active Site of RNA Polymerase II (REACT_80520), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_100578), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_103987), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), Formation of the closed pre-initiation complex (REACT_91116), Fall Back to Closed Pre-initiation Complex (REACT_98220), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Fall Back to Closed Pre-initiation Complex (REACT_100253), Formation of the closed pre-initiation complex (REACT_632), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_82574), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_85925), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), Fall Back to Closed Pre-initiation Complex (REACT_92728), Fall Back to Closed Pre-initiation Complex (REACT_1702), Abortive initiation after formation of the first phosphodiester bond (REACT_653), NTP Binds Active Site of RNA Polymerase II (REACT_1160), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_110236), Recognition and Binding of Core Promoter Elements by TFIID (REACT_82809), NTP Binds Active Site of RNA Polymerase II (REACT_106132), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Formation of the closed pre-initiation complex (REACT_105039), NTP Binds Active Site of RNA Polymerase II (REACT_80120), RNA Polymerase II Promoter Opening: First Transition (REACT_80107), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_88546), RNA Polymerase II Promoter Opening: First Transition (REACT_93391), RNA Polymerase II Promoter Opening: First Transition (REACT_89694), RNA Polymerase II Promoter Opening: First Transition (REACT_29850).
biological_process: transcription from RNA polymerase II promoter, gene expression, viral transcription, viral reproduction, transcription elongation from RNA polymerase II promoter, transcription initiation from RNA polymerase II promoter.
REACTOME_COMPLEX: pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), HIV-1 transcription complex [nucleoplasm] (REACT_6433), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), Pol II initiation complex [nucleoplasm] (REACT_5487), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), TFIID [nucleoplasm] (REACT_5886), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II promoter:TFIID complex [nucleoplasm] (REACT_5906), pol II promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_2339), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), pol II transcription complex [nucleoplasm] (REACT_2954), HIV-1 promoter:TFIID complex [nucleoplasm] (REACT_6369), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_6531), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450).
REACTOME_PATHWAY: HIV-1 Transcription Initiation (REACT_6332), RNA Polymerase II Transcription Initiation (REACT_105389), Transcription of the HIV genome (REACT_6233), RNA Polymerase II Pre-transcription Events (REACT_82727), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_28862), RNA Polymerase II Transcription (REACT_99950), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_85257), Formation and Maturation of mRNA Transcript (REACT_85219), Transcription (REACT_87991), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_83749), RNA Polymerase II Pre-transcription Events (REACT_99660), Formation and Maturation of mRNA Transcript (REACT_96378), Gene Expression (REACT_85241), Transcription (REACT_1788), Formation and Maturation of mRNA Transcript (REACT_92291), RNA Polymerase II Pre-transcription Events (REACT_91707), Gene Expression (REACT_71), RNA Polymerase II Transcription Initiation (REACT_104036), RNA Polymerase II Transcription (REACT_1366), HIV Life Cycle (REACT_6256), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_98915), Gene Expression (REACT_98256), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34355), Transcription (REACT_100899), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription Initiation (REACT_1851), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_78187), RNA Polymerase II Transcription Initiation (REACT_87429), RNA Polymerase II Pre-transcription Events (REACT_91410), RNA Polymerase II Transcription (REACT_97471), Formation and Maturation of mRNA Transcript (REACT_77979), Transcription (REACT_99758), RNA Polymerase II Pre-transcription Events (REACT_22107), HIV Infection (REACT_6185), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), Transcription (REACT_93622), RNA Polymerase II Promoter Escape (REACT_2089), RNA Polymerase II Promoter Escape (REACT_81662), RNA Polymerase II Transcription (REACT_89454), Gene Expression (REACT_105649), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_79444), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_109232), RNA Polymerase II Transcription Initiation (REACT_88340), Gene Expression (REACT_91657), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription (REACT_99228).
These properties come from phylome analysis
molecular_function: RNA polymerase binding, identical protein binding, estrogen receptor binding, transcription initiation factor activity, general RNA polymerase II transcription factor activity, transcription coactivator activity, chromatin binding, RNA polymerase II transcription factor activity.
cellular_component: perinuclear region of cytoplasm, SLIK (SAGA-like) complex, transcription factor TFTC complex, STAGA complex, transcription factor TFIID complex, PCAF complex, SAGA complex, nucleus.
biological_process: protein homooligomerization, RNA polymerase II transcriptional preinitiation complex assembly, histone H3 acetylation, gene-specific transcription from RNA polymerase II promoter, general transcription from RNA polymerase II promoter, histone deubiquitination, histone acetylation, viral reproduction, transcription elongation from RNA polymerase II promoter, transcription initiation from RNA polymerase II promoter, regulation of transcription, DNA-dependent, transcription initiation, DNA-dependent.
These properties come from blast2go analysis
molecular_function: translation initiation factor activity, RNA polymerase II transcription factor activity.
cellular_component: nucleus.
biological_process: transcription initiation, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003LMFX_CUCME .