Polypeptide MELO3C011446P2
Accession: MELO3C011446P2
Name: MELO3C011446P2
Description: Similar to Mitogen-activated protein kinase homolog MMK1 (Medicago sativa) (uniprot_sprot:sp|Q07176|MMK1_MEDSA)
Sequence:
>MELO3C011446P2 Similar to Mitogen-activated protein kinase homolog MMK1 (Medicago sativa) (uniprot_sprot:sp|Q07176|MMK1_MEDSA) MDDGGASQPDDTVMSEAASVPPPQHDPAAQQQHQHQPPSMGMENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGK GAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENVSE*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Interaction of p38 MAPK with JLP (REACT_21282), ERK5 is activated (REACT_100829), ERK5 is activated (REACT_104581), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_91195), Phosphorylated MAPKs phosphorylate ATF-2 (REACT_6719), ERK5 translocates to the nucleus (REACT_95956), Active p38 MAPK phosphorylates MAPKAPK2 or 3 (REACT_28738), p38MAPK phosphorylates MSK1 (REACT_105534), ERK5 activates the transcription factor MEF2 (REACT_86006), Phosphorylation of E proteins by p38 MAPK (REACT_21321), Nuclear export of human p38 MAPK mediated by its substrate MAPKAPK2 or 3 (REACT_95261), p38MAPK phosphorylates MSK1 (REACT_12546), activated human MKK3/MKK6 phosphorylates p38 MAPK complexed with MAPKAPK2 or MAPKAPK3 (REACT_21395), MAP kinase activates MAPKAPK2, MAPKAPK3 and MSK1 (REACT_85146), ERK5 activates the transcription factor MEF2 (REACT_97335), Phosphorylation of KSRP by MAP kinase p38 (REACT_24965), MAP kinase activates MAPKAPK2, MAPKAPK3 and MSK1 (REACT_12032), Phosphorylation of MEF2 proteins by p38 (REACT_21276), Activation of p38 MAPK (REACT_75807), Phosphorylation of cPLA2 by MAPK p38 alpha (REACT_20541), Nuclear export of human p38 MAPK mediated by its substrate MAPKAPK2 or 3 (REACT_21358), Active p38 MAPK phosphorylates MAPKAPK2 or 3 (REACT_21375), ERK5 translocates to the nucleus (REACT_110814).
biological_process: Ras protein signal transduction, innate immune response, activation of innate immune response, positive regulation of muscle cell differentiation, toll-like receptor 1 signaling pathway, toll-like receptor 3 signaling pathway, activation of MAPK activity, regulation of sequence-specific DNA binding transcription factor activity, MyD88-dependent toll-like receptor signaling pathway, toll-like receptor signaling pathway, toll-like receptor 2 signaling pathway, stress-activated MAPK cascade, MyD88-independent toll-like receptor signaling pathway, mRNA metabolic process, RNA metabolic process, nerve growth factor receptor signaling pathway, toll-like receptor 4 signaling pathway, muscle cell differentiation, nucleotide-binding oligomerization domain containing signaling pathway, platelet activation, Toll signaling pathway, blood coagulation.
REACTOME_COMPLEX: p38 MAPK : MAPKAPK2 or MAPKAPK3 [nucleoplasm] (REACT_22059), Phospho-MAP kinase p38 (Mg2+ cofactor) [cytosol] (REACT_12273), p38 alpha/beta/gamma:ABL1:JLP:CDO complex [plasma membrane] (REACT_21610), phospho-p38 MAPK : phospho MAPKAPK2 or phospho MaPKAPK3 [nucleoplasm] (REACT_21539), phospho-p38 MAPK : phospho MAPKAPK2 or phospho MaPKAPK3 [cytosol] (REACT_21519), phospho-p38 MAPK : MAPKAPK2 or MaPKAPK3 [nucleoplasm] (REACT_21530), pp38 alpha/beta/gamma:ABL1:JLP:CDO complex [plasma membrane] (REACT_21750), MAP kinase p38 (Mg2+ cofactor) [cytosol] (REACT_12099), phospho p38:phospho MEF2 [nucleoplasm] (REACT_21504).
REACTOME_PATHWAY: NGF signalling via TRKA from the plasma membrane (REACT_107118), ADP signalling through P2Y purinoceptor 1 (REACT_19140), Signalling to ERK5 (REACT_31272), Toll Like Receptor 9 (TLR9) Cascade (REACT_9047), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_28593), Regulation of mRNA Stability by Proteins that Bind AU-rich Elements (REACT_24994), ERK/MAPK targets (REACT_12599), MAP kinase activation in TLR cascade (REACT_82500), NGF signalling via TRKA from the plasma membrane (REACT_29880), Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways (REACT_75913), MAP kinase activation in TLR cascade (REACT_21308), Toll Like Receptor 3 (TLR3) Cascade (REACT_34013), MyD88:Mal cascade initiated on plasma membrane (REACT_99530), Myogenesis (REACT_21303), MyD88:Mal cascade initiated on plasma membrane (REACT_92018), Toll Like Receptor TLR6:TLR2 Cascade (REACT_79076), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_85188), Toll Like Receptor TLR6:TLR2 Cascade (REACT_106218), activated TAK1 mediates p38 MAPK activation (REACT_21399), Toll Like Receptor 2 Cascade (REACT_29705), Nuclear Events (kinase and transcription factor activation) (REACT_104146), Immune System (REACT_81385), Toll Like Receptor 5 (TLR5) Cascade (REACT_77312), NGF signalling via TRKA from the plasma membrane (REACT_12056), Signalling to ERKs (REACT_12058), Toll Like Receptor 10 (TLR10) Cascade (REACT_92313), Toll Like Receptor 10 (TLR10) Cascade (REACT_102819), MyD88 cascade initiated on plasma membrane (REACT_27215), ERK/MAPK targets (REACT_31447), Nuclear Events (kinase and transcription factor activation) (REACT_12433), Toll Like Receptor 5 (TLR5) Cascade (REACT_9061), Hemostasis (REACT_604), Toll Like Receptor TLR1:TLR2 Cascade (REACT_89891), MyD88 dependent cascade initiated on endosome (REACT_87458), Metabolism of RNA (REACT_21257), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_95028), Toll Receptor Cascades (REACT_6966), MyD88-independent cascade initiated on plasma membrane (REACT_28410), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_30390), ERK/MAPK targets (REACT_97877), MyD88 dependent cascade initiated on endosome (REACT_88704), Platelet homeostasis (REACT_23876), Toll Receptor Cascades (REACT_91529), Activation of the AP-1 family of transcription factors (REACT_21326), MAP kinase activation in TLR cascade (REACT_34622), p38MAPK events (REACT_33936), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_21328), Platelet sensitization by LDL (REACT_23879), Toll Like Receptor 2 Cascade (REACT_92918), NGF signalling via TRKA from the plasma membrane (REACT_102976), activated TAK1 mediates p38 MAPK activation (REACT_87442), Immune System (REACT_6900), Toll Like Receptor 5 (TLR5) Cascade (REACT_82163), Toll Like Receptor TLR6:TLR2 Cascade (REACT_103395), MyD88 cascade initiated on plasma membrane (REACT_96209), CDO in myogenesis (REACT_21402), Toll Like Receptor 9 (TLR9) Cascade (REACT_103126), Signalling to RAS (REACT_12033), Signalling to RAS (REACT_79426), Immune System (REACT_84034), Toll Like Receptor 5 (TLR5) Cascade (REACT_30810), Signal amplification (REACT_20524), MAP kinase activation in TLR cascade (REACT_98311), Toll Like Receptor 2 Cascade (REACT_7980), Signalling by NGF (REACT_11061), Toll Like Receptor 9 (TLR9) Cascade (REACT_93905), Platelet activation triggers (REACT_622), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79305), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_33857), Toll Like Receptor 9 (TLR9) Cascade (REACT_32391), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_95399), MyD88 cascade initiated on plasma membrane (REACT_104035), MyD88-independent cascade initiated on plasma membrane (REACT_85813), MyD88 dependent cascade initiated on endosome (REACT_29524), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_106858), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91838), Platelet Activation (REACT_798), Immune System (REACT_105951), Metabolism of mRNA (REACT_20605), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_96421), Toll Like Receptor TLR6:TLR2 Cascade (REACT_8006), Toll Like Receptor TLR1:TLR2 Cascade (REACT_8005), NOD1/2 Signaling Pathway (REACT_75776), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_34578), Toll Like Receptor 3 (TLR3) Cascade (REACT_87070), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_34570), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91544), Signalling to ERKs (REACT_32318), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_104956), Signalling by NGF (REACT_97378), Toll Like Receptor 2 Cascade (REACT_109018), MyD88-independent cascade initiated on plasma membrane (REACT_99643), MyD88 cascade initiated on plasma membrane (REACT_81183), Toll Like Receptor 4 (TLR4) Cascade (REACT_80044), Toll Like Receptor 3 (TLR3) Cascade (REACT_99649), Signalling to ERK5 (REACT_107061), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_25024), Nuclear Events (kinase and transcription factor activation) (REACT_90219), Innate Immunity Signaling (REACT_95642), Formation of Platelet plug (REACT_20), MyD88 dependent cascade initiated on endosome (REACT_25222), Activated TLR4 signalling (REACT_90914), ERK/MAPK targets (REACT_31414), Signalling by NGF (REACT_90112), Toll Receptor Cascades (REACT_85362), Toll Like Receptor 4 (TLR4) Cascade (REACT_109895), Innate Immunity Signaling (REACT_88681), Activated TLR4 signalling (REACT_91273), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_85088), MyD88:Mal cascade initiated on plasma membrane (REACT_80624), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_9020), Toll Like Receptor 10 (TLR10) Cascade (REACT_9027), Toll Like Receptor 3 (TLR3) Cascade (REACT_6783), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_6782), Signalling by NGF (REACT_82686), Innate Immunity Signaling (REACT_108180), Toll Receptor Cascades (REACT_98692), MyD88:Mal cascade initiated on plasma membrane (REACT_6788), Toll Like Receptor 4 (TLR4) Cascade (REACT_6894), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_78994), Activated TLR4 signalling (REACT_6890), p38MAPK events (REACT_12065), Nuclear Events (kinase and transcription factor activation) (REACT_82900), Activated TLR4 signalling (REACT_33197), MyD88-independent cascade initiated on plasma membrane (REACT_6809), Destabilization of mRNA by KSRP (REACT_25042), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_25281), Innate Immunity Signaling (REACT_6802), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79068), Toll Like Receptor 4 (TLR4) Cascade (REACT_91584), Toll Like Receptor 10 (TLR10) Cascade (REACT_110819).
These properties come from phylome analysis
molecular_function: ATP binding, MAP kinase activity.
biological_process: protein phosphorylation.
These properties come from blast2go analysis
molecular_function: ATP binding, protein binding, MAP kinase activity.
biological_process: cell division, mitosis, protein phosphorylation, conjugation.
This polypeptide in other databases
In PhylomeDB is Phy003MJD8_CUCME .
